KEGG   Escherichia coli O7 K1 CE10: CE10_3210Help
Entry
CE10_3210         CDS       T01999                                 

Gene name
barA
Definition
hybrid sensory histidine kinase, in two-component regulatory system with UvrY
Orthology
K07678  
two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Two-component system
Module
BarA-UvrY (central carbon metabolism) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:eoc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3267299..3270055
Genome map
AA seq 918 aa AA seqDB search
MTNYSLRARMMILILAPTVLIGLLLSIFFVVHRYNDLQRQLEDAGASIIEPLAVSTEYGM
SLQNRESIGQLISVLHRRHSDIVRAISVYDENNRLFVTSNFHLDPSSMQLGSNVPFPRQL
TVTRDGDIMILRTPIISESYSPDESPSSDAKNSQNMLGYIALELDLKSVRLQQYKEIFIS
SVMMLFCIGIALIFGWRLMRDVTGPIRNMVNTVDRIRRGQLDSRVEGFMLGELDMLKNGI
NSMAMSLAAYHEEMQHNIDQATSDLRETLEQMEIQNVELDLAKKRAQEAARIKSEFLANM
SHELRTPLNGVIGFTRLTLKTELTPTQRDHLNTIERSANNLLAIINDVLDFSKLEAGKLI
LESIPFPLRSTLDEVVTLLAHSSHDKGLELTLNIKSDVPDNVIGDPLRLQQIITNLVGNA
IKFTENGNIDILVEKRALSNTKVQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRRHG
GTGLGLVITQKLVNEMGGDISFHSQPNRGSTFWFHINLDLNPNIIIEGPSTQCLAGKRLA
YVEPNSAAAQCTLDILSETPLEVVYSPTFSALPPAHYDMMLLGIAVTFREPLTMQHERLA
KAVSMTDFLMLALPCHAQVNAEKLKQDGIGACLLKPLTPTRLLPALTEFCHHKQNTLLPV
TDESKLAMTVMAVDDNPANLKLIGALLEDMVQHVELCDSGHQAVERAKQMPFDLILMDIQ
MPDMDGIRACELIHQLPHQQQTPVIAVTAHAMAGQKEKLLGAGMSDYLAKPIEEERLHNL
LLRYKPGSGISSRVVTPEVNEIVVNPNATLDWQLALRQAAGKTDLARDMLQMLLDFLPEV
RNKVEEQLVGENPEGLVDLIHKLHGSCGYSGVPRMKNLCQLIEQQLRSGTKEEDLEPELL
ELLDEMDNVAREASKILG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaccaactacagcctgcgcgcacgcatgatgattctgatcctggcaccgaccgtcctt
attggtttattgctgagtatctttttcgtcgtgcatcgctataacgacttgcagcgtcaa
ctggaagatgccggtgccagcattattgagccgcttgcagtttctactgaatatggcatg
agtctgcaaaatcgcgaatctatcggtcagttaataagcgtactgcatcgtcgccattcc
gatattgttcgcgcgatttcggtttatgatgaaaataaccgactctttgtcacctccaat
tttcatcttgatccctcatcaatgcagctcggcagcaacgtgccgtttcctcgccagctc
actgtcactcgtgacggcgatataatgatcctccgcacgccgattatttctgaaagttac
tcccccgacgaatcgcccagtagcgatgccaaaaatagtcaaaatatgctgggatatatt
gcgctggagctggatcttaaatcggttcgcttgcagcaatataaagagatctttatttcc
agcgtgatgatgctgttttgtatcggtattgcgcttatttttggctggcgcttaatgcgc
gatgttaccggcccgattcgcaacatggtgaataccgtcgaccgcatccgtcgtgggcaa
ctcgatagccgggtggaaggatttatgcttggtgagctggatatgctgaaaaacggtatc
aactcgatggcaatgtcgctggcggcttatcacgaagagatgcaacacaatatcgaccag
gcgacgtccgatctgcgtgaaacgctggagcagatggagattcagaacgttgagttggat
ctggcgaaaaagcgcgcccaggaagcggcgcgtattaaatccgagtttctggcaaatatg
tcacacgagctgcgtacaccactgaatggtgttattggctttacccgcctgacgctgaaa
acagaattaacaccaacgcagcgcgatcacctgaatacgattgaacgttcggcaaataat
ttgctggcaattattaatgatgttctcgacttctcgaaactggaagccggtaagctgatt
ctggaaagtattccattcccactacgcagcacgctggatgaagtcgttaccctactggca
cattcttctcacgataaagggctggaactgacgctcaatattaaaagcgacgtgcctgat
aacgtgatcggcgacccactacgattacagcaaatcatcactaacctggtggggaatgca
attaaattcaccgagaatggcaacattgatattctggtagaaaaacgtgcgctgagtaat
accaaagtgcaaattgaagtgcagattcgggataccggcattggtattcctgaacgcgat
caatcgcgcttattccaggccttcagacaggctgatgccagtatttcccgccgtcatggt
ggcaccgggctggggctggtgattacacaaaaactggttaatgaaatgggcggtgatatt
tcgttccatagccagccgaatcgtggttcaactttctggttccacattaatctcgatctg
aacccgaacattattatcgaagggccatccacccagtgcctcgccggtaagcgcctggcc
tatgtcgaaccaaactccgcagcagcgcaatgcacgctggatattttaagtgaaacgccg
ctggaagtggtttatagcccaacgttctccgcgctgcctcccgcgcattacgacatgatg
ttattaggcatcgcggtgaccttccgcgagccgctaacaatgcaacatgagcgattagcg
aaagcagtatcgatgaccgattttctgatgctggcacttccttgccatgcacaagtcaat
gctgaaaaacttaagcaagatggtatcggcgcgtgtctgctgaaaccattaacacctacg
cgcctgttacctgccctgacggaattttgtcatcacaaacaaaacacgcttttgcctgta
accgatgaaagtaagctggcaatgacagtcatggcggttgatgacaaccccgctaacctg
aaacttatcggcgcattgctggaagatatggtgcaacatgtggaactttgcgatagcggg
catcaggcggttgaacgggcgaaacagatgccgttcgatttgatcttaatggatattcaa
atgccggacatggacggcattcgggcctgcgaactcatccaccagctcccccatcagcaa
caaacgccggttatcgcggtaacggcgcatgcaatggccgggcaaaaagagaagctgctt
ggcgcagggatgagcgattatctggcgaaaccgattgaagaagagcgattgcataatttg
ttgttgcgctataagcctggcagcggtatttcctctcgcgtcgtgacgcccgaagtcaac
gaaattgtggtgaacccgaatgcgaccctcgactggcaactggcactacgccaggcagca
ggaaaaaccgatttagcgcgcgatatgctgcaaatgttactcgatttcctgcctgaagtt
cgcaacaaagttgaggaacagctggttggagaaaacccggaaggcttggttgatttgatt
cataaactgcatggcagttgcggctatagcggtgtgccgcgtatgaagaatctctgccaa
ctgatcgaacaacagctacgtagcggtactaaagaagaagatttggagccggagctgctg
gaactgttagacgagatggataatgtagcgcgcgaagccagcaaaattctcgggtaa

DBGET integrated database retrieval system