KEGG   Escherichia coli O7 K1 CE10: CE10_3229Help
Entry
CE10_3229         CDS       T01999                                 

Gene name
fucI
Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CE10_3229 (fucI)
Enzymes [BR:eoc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     CE10_3229 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3287873..3289648
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDT
CIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDGSCKQRDSEGNPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLASMLRISVCMHNVEETKVYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaattggtatccgcccggttattgacggtcgtcgcatg
ggtgttcgtgagtcgcttgaagaacaaacaatgaatatggcgaaagctacggccgcactg
ctgaccgagaaactgcgccatgcctgcggagctgccgtcgagtgtgtcatttccgatacc
tgtatcgcgggtatggctgaagccgctgcttgcgaagaaaaattcagcagtcagaatgta
ggcctcaccattacggtaacgccttgctggtgctatggcagtgaaaccatcgacatggat
ccaacccgcccgaaagccatttggggctttaacggcactgaacgccccggcgctgtttac
ctggctgcggctctggcagctcacagccagaaaggcatcccggcattctccatttacggt
catgacgttcaggatgccgatgacacatcgattcctgctgatgttgaagaaaaactgctg
cgctttgcccgcgccggtttggccgtcgccagcatgaaaggtaaaagctatctgtcgctg
ggcggcgtttcgatgggtatcgccggttccattgttgatcacaacttctttgaatcctgg
ctgggaatgaaagtccaggcagtggatatgaccgaactgcgtcgccgtatcgatcagaag
atttacgacgaagccgaactggaaatggcgctggcctgggctgataaaaacttccgctat
ggcgaagatgaaaataacaaacagtatcaacgcaatgccgagcaaagccgcgcagttctg
cgcgaaagtttactgatggcgatgtgtatccgcgacatgatgcaaggcaacagcaaactg
gccgatattggtcgcgtggaagaatcacttggctacaacgccatcgctgcgggcttccag
ggacaacgccactggaccgatcaatatcccaatggtgacaccgccgaagcgatcctcaac
agttcatttgactggaatggcgtgcgcgaaccctttgtcgtggcgaccgaaaacgacagt
cttaacggcgtggcaatgctaatgggtcaccaactcaccggcaccgcgcaagtatttgcc
gatgtgcgtacctactggtcaccagaagcaattgagcgtgtaacggggcataaactggac
ggactggcagaacacggcatcatccatttgatcaactccggttctgctgcgctggacggt
tcctgtaaacaacgcgacagcgaaggtaacccgacgatgaagccacactgggaaatctct
cagcaagaggctgacgcttgcctcgccgctaccgaatggtgcccggcgatccacgaatac
ttccgtggcggcggttactcttcccgcttccttaccgaaggcggcgtcccgttcaccatg
actcgtgtcaacatcatcaaaggcctgggaccggtactgcaaatcgcggaaggctggagc
gtggaattgccgaaggatgtgcatgacatcctcaacaaacgcaccaactcaacctggcca
accacctggtttgcaccgcgcctcaccggtaaagggccgtttacggatgtgtactcggta
atggcgaactggggcgctaaccacggggttctaaccatcggccacgttggcgcagacttt
atcactcttgcctccatgctgcgtatctcggtatgtatgcacaacgttgaagagaccaaa
gtgtatcgtccttctgcctgggccgcgcacggcatggatattgaaggccaggattatcgc
gcttgccagaactacggcccgttgtacaagcgttaa

DBGET integrated database retrieval system