KEGG   Escherichia coli O7 K1 CE10: CE10_3501Help
Entry
CE10_3501         CDS       T01999                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eoc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eoc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eoc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3570041..3572212)
Genome map
AA seq 723 aa AA seqDB search
MSQTITQGRLRINANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRHYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQSEFNAEFEPLLDDLLTIPVAENANWSVEEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHSILTKEQVQASL
ENMAKVVDQQNAGDPAYRPMSGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagggccgtttacgcattaacgccaattttaaacgttttgtg
gatgaagaagttttaccgggaacagggttggacgctgcggcgttctggcgcaattttgat
gagatcgttcacgatctggcaccagaaaatcgtcagttgctggcagaacgcgatcgcatt
caggcggcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtgccgcaaccggagcgcgtaacggtg
gaaaccacgggcattgacagcgaaatcaccagtcaggcggggccacagctggtggttccg
gcaatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
cagcgtggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatcactaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggtcgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtaccccggcgcagtttgtcggttaccgt
ggcgatgccgctgcgccgacctgcattttgctgaaaaataacggtctgcatattgaactg
caaattgatgccaacgggcggattggcaaagacgatccggcgcatatcaacgatgttatc
gtcgaagcggccatcagtaccattctcgactgcgaagattcggtcgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggaaaaaaacggtcggcaaatcgtgcgtaaactgaatgacgatcgtcattacacc
gccgccgatggctctgaaatttctctgcacggacgctcgctgctgtttatccgcaacgtg
ggtcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggcgtcatgactggcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgtttacccgcattgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgtcggacctcgctgaacttgcgtagctgtatcgct
caggcgcgtaaccgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagctggcccgatgctgcgtaaaaaccagatgaaatcgacgccg
tggatcaaagcctacgaacgtaataacgtgctttccggtctgttctgtgggctgcgcggt
aaagcgcaaatcggtaaagggatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaactgcgtgccggggcaaacacagcctgggttccgtcaccaaccgct
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaggccaacatt
gcccagagcgagttcaatgctgaatttgaaccgctgctggacgatctgctgactattccg
gtggctgaaaacgctaactggtcggttgaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgttgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaacgtggcgctgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacagtattctgaccaaagaacaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccgatg
tcggggaatttcgctaactcgtgtgcttttaaagctgccagcgatttaatcttcctcggc
gtgaaacagccaaacggctataccgaaccgttattacacgcctggcgtttacgcgaaaaa
gaaagtcattaa

DBGET integrated database retrieval system