KEGG   Escherichia coli O7 K1 CE10: CE10_4077Help
Entry
CE10_4077         CDS       T01999                                 

Gene name
bcsZ
Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eoc  Escherichia coli O7:K1 CE10
Brite
Enzymes [BR:eoc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CE10_4077 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4146879..4147985)
Genome map
AA seq 368 aa AA seqDB search
MNVLRSGLVTMLLLAAFSVQAACNWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYG
MFFALAANDRAAFDNILDWAQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGEVW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGF
SAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDW
GQECANSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttgcgtagtggactcgtgacgatgctgctgctggctgcctttagtgttcag
gcagcctgcaactggcctgcctgggagcagttcaaaaaggattacatcagtcaggaaggg
cgcgtcattgacccaagtgacgcgcgtaaaatcaccacttccgaagggcaaagttacggc
atgttctttgccctggcggctaacgaccgtgcagctttcgataatattctcgactgggcg
cagaacaatctcgctcagggttctttaaaagaacgtttgcccgcatggctgtggggcaag
aaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgaagtctgg
atggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatc
ggcagcgcgttgttaaaacgtattgcgcgggaggaagtggtgacggtgcctgggctgggt
tccatgttgttgccgggcaaagtgggatttgcagaggataacagctggcgttttaacccc
agctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggactacg
ctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcgccagac
tgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagc
agctacgacgcgatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaa
aaagcgcggatgctcaaccggtttaaaccgatggcgacattcaccgagaaaaacggctat
ccgccagaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccggtcggtttt
tctgccgccatgctgccctttttacaaaaccgcgatgcacaggccgttcagcgccagcgc
gtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctgtttgga
caaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactgg
ggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system