KEGG   Escherichia coli O7 K1 CE10: CE10_4448Help
Entry
CE10_4448         CDS       T01999                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00860  Porphyrin and chlorophyll metabolism
eoc01100  Metabolic pathways
eoc01110  Biosynthesis of secondary metabolites
eoc01120  Microbial metabolism in diverse environments
Module
eoc_M00121  Heme biosynthesis, glutamate => heme
eoc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CE10_4448 (hemD)
Enzymes [BR:eoc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CE10_4448 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 GATase_4
Motif
Other DBs
NCBI-ProteinID: AEQ15137
UniProt: A0A0E0VC36
Position
complement(4535403..4536143)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPDYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELIGDTLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
TVVVTSGEMLQQLWSLIPQWYREHWLLHCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctggtcacccgcccgtctcccgctggagaagagttagtgagccgtctgcgc
acactggggcaggtggcctggcattttccactgattgagttttctccgggtcgacaatta
ccacaacttgctgatcaactggcggcgctgggggagagcgatctgttgtttgccctctcg
caacacgcggttgcttttgcccaatcacagctgcatcagcaagatcgtaaatggccccga
ctacctgattatttcgccattggacgcaccaccgcactggcactacataccgtaagcgga
cagaagattctctacccgcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggcaaacgtgcgctgatattacgtggcaatggcggtcgtgagcta
attggggataccctgacggcgcgcggtgctgaggtcactttttgtgaatgttatcaacga
tgcgcaatccattacgatggtgcagaagaagcgatgcgctggcaatcccgcgaggtgacg
acggtcgttgttaccagcggtgaaatgttgcagcaactctggtcgctgatcccacaatgg
tatcgtgagcactggttactacactgtcgactattggtcgtcagtgagcgtttggcgaaa
ctcgcccgggaactgggctggcaagacattaaggtcgccgataacgctgacaacgatgcg
cttttacgggcattacaataa

DBGET integrated database retrieval system