KEGG   Escherichia coli O7 K1 CE10: CE10_4471Help
Entry
CE10_4471         CDS       T01999                                 

Gene name
pldA
Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CE10_4471 (pldA)
   00565 Ether lipid metabolism
    CE10_4471 (pldA)
   00590 Arachidonic acid metabolism
    CE10_4471 (pldA)
   00591 Linoleic acid metabolism
    CE10_4471 (pldA)
   00592 alpha-Linolenic acid metabolism
    CE10_4471 (pldA)
Enzymes [BR:eoc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CE10_4471 (pldA)
    3.1.1.32  phospholipase A1
     CE10_4471 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4556659..4557528
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYI
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYNFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcaccctttatccttatgacaccaactacatc
atctatacccaaaccagcgacctgaataaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcgtttccgctgtggcgtggg
attttaggcccgaactcggtgttgggggcgtcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaactaactacgaaccgcaattgttcctc
ggttttgccacggattacaactttgctggctggacgctgcgcgatgtggaaatgggctac
aaccacgactcaaacgggcgttcagacccgacttcccgcagctggaaccgcctttatacc
cgcctgatggcagaaaacggtaactggctggtagaggtgaagccgtggtatgtggtgggg
aatacggacgataacccggacatcaccaaatatatgggctattaccagcttaaaatcggc
tatcacctcggtgatgcggtactgagcgcgaaagggcagtacaactggaacaccggttac
ggtggtgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagtggttacggcgaatcgctcatcgactataacttcaaccagacccgcgttggt
gtgggagttatgctaaacgacctgttttga

DBGET integrated database retrieval system