KEGG   Escherichia coli O7 K1 CE10: CE10_4475Help
Entry
CE10_4475         CDS       T01999                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:eoc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4560958..4561980
Genome map
AA seq 340 aa AA seqDB search
MFQQQKDWETRENAFAAFTMGPLTDFWRQRDEAEFTGVDDIPVRFVRFRAQHHDRVVVIC
PGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLGDPHLGHVNRFNDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRHPGVCDAIALTAPMFGIVIRMPSFMARQI
LNWAEAHPRFRDGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADDPTIRVGGPTYHW
VRESILAGEQVLAGAGDDATPTLLLQAEEERVVDNRMHDRFCELRTAAGHPVEGGRPLVI
KGAYHEILFEKDAMRSVALHAIVDFFNRHNSPSGNRSTEV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaaagactgggaaacaagagaaaacgcgtttgctgcttttaccatg
ggaccgctgactgatttctggcgtcagcgtgatgaagcagaatttactggtgtggatgac
attccggtgcgctttgtccgttttcgcgcgcagcaccatgaccgggtggtagtcatctgc
ccggggcgtattgagagctacgtaaaatatgcggaactggcctacgacctgttccatttg
gggtttgatgttttaatcatcgaccatcgcgggcagggacgttccggtcgcctgttaggc
gatccacatctcgggcatgttaatcgctttaatgattatgttgatgatctggcggcattc
tggcaacaggaggttcagcccggtccgtggcgtaaacgctatatactggcacattcgatg
ggcggtgcgatctccacattatttctgcaacgtcatccaggtgtatgtgacgccattgcg
ctaactgcgccaatgtttgggatcgtgattcgtatgccgtcatttatggcacggcagatc
ctcaactgggccgaagcgcatccacgtttccgtgatggctatgcaataggcaccgggcgc
tggcgcgcgttgccgtttgctatcaacgtactgacccacagcagacagcgatatcgacgt
aacttacgcttctatgctgatgatccaacgattcgcgtcggtgggccgacctaccattgg
gtacgcgaaagtattctggctggcgaacaggtgttagccggtgcgggtgatgacgccacg
ccaacgcttctcttacaagctgaagaggaacgcgtggtggataaccgcatgcatgaccgt
ttttgtgaactccgcaccgctgcgggccatcctgtcgaaggaggacggccgttggtaatt
aaaggtgcgtaccatgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctccac
gccatcgttgattttttcaacaggcataactcacccagcggaaaccgctctacagaggtt
taa

DBGET integrated database retrieval system