KEGG   Escherichia coli O7 K1 CE10: CE10_4475Help
Entry
CE10_4475         CDS       T01999                                 

Gene name
pldB
Definition
(GenBank) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CE10_4475 (pldB)
Enzymes [BR:eoc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CE10_4475 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIDHydrolase Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: AEQ15164
UniProt: A0A0E0VCA7
Position
4560958..4561980
Genome map
AA seq 340 aa AA seqDB search
MFQQQKDWETRENAFAAFTMGPLTDFWRQRDEAEFTGVDDIPVRFVRFRAQHHDRVVVIC
PGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLGDPHLGHVNRFNDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRHPGVCDAIALTAPMFGIVIRMPSFMARQI
LNWAEAHPRFRDGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADDPTIRVGGPTYHW
VRESILAGEQVLAGAGDDATPTLLLQAEEERVVDNRMHDRFCELRTAAGHPVEGGRPLVI
KGAYHEILFEKDAMRSVALHAIVDFFNRHNSPSGNRSTEV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaaagactgggaaacaagagaaaacgcgtttgctgcttttaccatg
ggaccgctgactgatttctggcgtcagcgtgatgaagcagaatttactggtgtggatgac
attccggtgcgctttgtccgttttcgcgcgcagcaccatgaccgggtggtagtcatctgc
ccggggcgtattgagagctacgtaaaatatgcggaactggcctacgacctgttccatttg
gggtttgatgttttaatcatcgaccatcgcgggcagggacgttccggtcgcctgttaggc
gatccacatctcgggcatgttaatcgctttaatgattatgttgatgatctggcggcattc
tggcaacaggaggttcagcccggtccgtggcgtaaacgctatatactggcacattcgatg
ggcggtgcgatctccacattatttctgcaacgtcatccaggtgtatgtgacgccattgcg
ctaactgcgccaatgtttgggatcgtgattcgtatgccgtcatttatggcacggcagatc
ctcaactgggccgaagcgcatccacgtttccgtgatggctatgcaataggcaccgggcgc
tggcgcgcgttgccgtttgctatcaacgtactgacccacagcagacagcgatatcgacgt
aacttacgcttctatgctgatgatccaacgattcgcgtcggtgggccgacctaccattgg
gtacgcgaaagtattctggctggcgaacaggtgttagccggtgcgggtgatgacgccacg
ccaacgcttctcttacaagctgaagaggaacgcgtggtggataaccgcatgcatgaccgt
ttttgtgaactccgcaccgctgcgggccatcctgtcgaaggaggacggccgttggtaatt
aaaggtgcgtaccatgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctccac
gccatcgttgattttttcaacaggcataactcacccagcggaaaccgctctacagaggtt
taa

DBGET integrated database retrieval system