KEGG   Escherichia coli O7 K1 CE10: CE10_4594Help
Entry
CE10_4594         CDS       T01999                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CE10_4594 (glpK)
Enzymes [BR:eoc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CE10_4594 (glpK)
Exosome [BR:eoc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CE10_4594 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4681584..4683092)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSST
LVEVLAKADISADQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDG
LEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYAGWKKAVKRAMAWEEHDE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggcaccaccagctcccgcgcggtc
gtaatggatcacgatgccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctac
ccaaaaccaggctgggtagaacacgacccaatggaaatctgggccacccaaagctccacg
ctggtagaagtgctggcgaaagccgatatcagtgccgatcaaattgcagctatcggtatt
acgaaccagcgtgaaaccactattgtctgggaaaaagaaaccggcaagcctatctataac
gccattgtctggcagtgccgtcgtaccgcagaaatctgcgagcatttaaaacgtgacggt
ttagaagattatatccgcagcaataccggtctggtgattgacccgtacttttctggcacc
aaagtgaagtggatcctcgaccatgtggaaggctctcgcgagcgtgcacgtcgtggtgaa
ttgctgtttggtacggttgatacgtggcttatctggaaaatgactcagggccgtgtccat
gtgaccgattacaccaacgcctctcgtaccatgttgttcaacattcataccctggactgg
gacgacaaaatgctggaggtgctggatattccgcgcgagatgctgccagaagtgcgtcgt
tcttccgaagtatacggtcagactaacattggcggcaaaggcggcacgcgtattccaatc
tctgggatcgccggtgaccagcaggcggcgctgtttggtcagttgtgcgtgaaagaaggg
atggcgaagaatacctacggcactggctgctttatgctgatgaacaccggcgagaaagcg
gtgaaatcagaaaacggcctgctgaccaccatcgcctgtggcccaactggcgaagtaaac
tatgcgctggaaggtgcggtgtttatggcgggcgcatccattcagtggctgcgcgatgag
atgaagttgattaacgacgcgtacgattccgaatactttgccacgaaagtgcaaaacacc
aacggtgtgtatgtggtgccggcatttaccgggctgggtgcgccgtactgggatccgtat
gcgcgcggggcgattttcggtctgactcgtggggtgaacgctaaccacattatacgcgcg
acgctggagtctattgcttatcagacacgtgacgtgctggaagcgatgcaggccgactcc
ggtattcgtctgcacgccctgcgcgtggatggcggcgcagtggcgaacaatttcctgatg
cagttccagtccgatattctcggcacgcgcgttgaacgcccggaagtgcgcgaagtcacc
gcattgggtgcggcctatcttgctggtctggcggttggcttctggcagaacctcgacgag
ctgcaagagaaagcggtgattgagcgcgagttccgtccaggcatcgaaaccactgagcgt
aattaccgttacgcaggctggaaaaaagcggtgaaacgcgcgatggcgtgggaagaacac
gacgagtaa

DBGET integrated database retrieval system