KEGG   Escherichia coli O7 K1 CE10: CE10_4783Help
Entry
CE10_4783         CDS       T01999                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
eoc00010  Glycolysis / Gluconeogenesis
eoc00620  Pyruvate metabolism
eoc00640  Propanoate metabolism
eoc00680  Methane metabolism
eoc01100  Metabolic pathways
eoc01110  Biosynthesis of secondary metabolites
eoc01120  Microbial metabolism in diverse environments
eoc01130  Biosynthesis of antibiotics
eoc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eoc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE10_4783 (acs)
   00620 Pyruvate metabolism
    CE10_4783 (acs)
   00640 Propanoate metabolism
    CE10_4783 (acs)
  Energy metabolism
   00680 Methane metabolism
    CE10_4783 (acs)
Enzymes [BR:eoc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CE10_4783 (acs)
Lipid biosynthesis proteins [BR:eoc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CE10_4783 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEQ15454
UniProt: A0A0E0VD24
Position
complement(4885827..4887785)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
IEQASDQHQAQEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcaccagataccttctggggc
gaacagggaaaaattctcgactggatcaaaccttaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcgaac
tgccttgaccgccatctgcaagaaaacggcgatcgcaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgacgtagttgcgatttatatgccg
atggtaccggaagccgcggtcgcgatgctggcctgcgcccgcattggcgcggtacattcg
gtgattttcggcggcttctcgccggaagccgttgccggacgcattatcgattctaactca
cgactggtgatcacttccgacgaaggcgtgcgtgccgggcgtagtattccgctgaagaaa
aacgtcgatgacgcgctgaaaaatccgaatgtcactagcgttgagcatgtggtggtactg
aagcgtactggcggaaaaattgactggcaggaagggcgcgatctgtggtggcacgacctg
attgagcaagcgagcgatcagcaccaggcgcaagagatgaacgccgaagatccactgttt
attctctatacctccggttccaccgggaagccgaaaggcgtgctgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggttaccggacacagttatttgctgtatggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcccaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
atccgcgcgctgatggcagaaggcgataaagcgatcgaaggcactgaccgttcgtcgctg
cgcattctcggttccgtaggcgagccaatcaacccggaagcgtgggagtggtactggaag
aagatcggcaacgagaaatgtccggtagtcgacacctggtggcagaccgaaaccggcggt
ttcatgatcacgccactgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggggctacc
gaaggcagcctggtgatcaccgactcctggcctggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgcgtggacgacgtgctg
aacgtctcgggtcaccgtctgggaacggcggagattgagtcggcgctggtggcgcatccg
aaaatcgccgaagccgctgtcgtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcatggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system