KEGG   Escherichia coli O7 K1 CE10: CE10_4960Help
Entry
CE10_4960         CDS       T01999                                 

Gene name
cysQ
Definition
adenosine 3'-phosphate 5'-phosphosulfate 3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
eoc  Escherichia coli O7:K1 CE10
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:eoc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5066156..5066896
Genome map
AA seq 246 aa AA seqDB search
MLDQVCQLARNAGDAIMQVYDGTKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVM
NVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagtatgccagcttgcacggaatgcaggcgatgccattatgcaggtctac
gacgggacgaaaccgatggacgtcgtcagcaaagcggacaattctccggtaacggcagcg
gatattgccgcacacaccgttatcatggacggtttacgtacgctgacaccggatattccg
gtcctttctgaagaagatcctcccggttgggaagtccgtcagcactggcagcgttactgg
ctggtagacccgctggatggtactaaagagtttattaaacgtaatggcgaatttaccgtt
aacattgcgctcatcgaccacggcaaaccgattttaggtgtggtgtatgcgccggtaatg
aacgtaatgtacagcgcggcagaaggcaaagcctggaaagaagagtgcggtgtgcgcaag
cagattcaggtccgcgatgcgcgcccgccgctggtggtgatcagccgttcccatgcagat
gcggagctgaaagagtatctgcaacagcttggcgaacatcagaccacgtccatcggctct
tcgctgaaattctgcctggtggcggaaggacaggcgcagctgtacccgcgtttcgggcca
acgaatatttgggataccgccgctggtcatgctgtggctgccgctgccggagcacatgtt
cacgactggcagggtaaaccgctggattacactccgcgcgagtcgttcctgaatccgggg
ttcagagtgtctatttattaa

DBGET integrated database retrieval system