KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0087Help
Entry
ECO103_0087       CDS       T01096                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eoh00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eoh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94883..96370
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKGEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIVN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIE
SHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtgccagacgcaccttcgcga
gcactgcgagagatgacactcgacagccgtgtggctgcggcgggcgatctctttgtagct
gtagtaggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgcagaggcgaaaggtgaggcgaccgacggtgaaatccgtgaaatgcac
ggcgtaccggtcatctatctcagccagctcaacgagcgtttatctgcactggcgggccgc
ttttaccatgaaccctctgacaatttacgtctcgtaggcgtaacgggcaccaacggcaaa
accacgactacccagctgctggcgcagtggagccaactgcttggcgaaaccagcgcggta
atgggcaccgttggtaacggtctgctggggaaagtgatcccgacagaaaataccaccggt
tcggcagtcgatgttcagcatgagctggcggggctggtggatcagggcgcgacgttttgc
gcaatggaagtttcctcccacgggctggtacagcaccgtgtggcggcattgaaatttgcg
gcgtcggtctttaccaacttaagccgcgatcaccttgattatcatggtgatatggaacac
tacgaagccgcgaaatggctgctttattctgaacatcattgtggtcaggcgattgttaac
gccgacgatgaagtgggccgccgctggctggcaaaactgccggacgcggttgcggtatca
atggaagatcatatcaatccgaactgtcacggacgctggttgaaagcgaccgaagtgaac
tatcacgacagcggcgcgaccattcgctttagttcaagttggggcgatggcgaaattgaa
agccatctgatgggcgcttttaacgtcagcaacctgctgctcgcgctggcgacactgctg
gcacttggctacccgctggctgatctgttaaaaaccgccgcgcgtctgcaaccggtttgc
ggacgtatggaagtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcat
acgccggatgcactggaaaaagccttacaggcggcgcgcctgcactgtgcgggcaagctg
tggtgcgtctttggctgtggtggcgatcgcgataaaggtaagcgtccactgatgggcgca
attgccgaagagtttgctgacgtggcggtggtgacggacgataacccgcgtaccgaagaa
ccgcgtgccatcatcaacgatattctggcgggaatgttagatgccggacatgccaaagtg
atggaaggccgtgctgaagcggtgacttgcgccgttatgcaggctaaagagaatgatgtg
gtactggtcgcgggcaaaggccatgaggattaccagattgttggcaatcagcgtctggac
tactccgatcgcgtcacggtggcgcgtctgctgggggtgattgcatga

DBGET integrated database retrieval system