KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_0142Help
Entry
ECO103_0142       CDS       T01096                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECO103_0142 (folK)
Enzymes [BR:eoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ECO103_0142 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(158651..159130)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILAVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttgccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacctcaacgccgccgtggcg
cttgaaacttcgctcgccccggaagagttactcaaccatacacagcgcatagaactgcaa
cagggtcgtgttcgtaaagctgaacgctggggaccacgcacgctggatctcgatatcatg
ctgtttggtaatgaagtgataaataccgaacgcctgaccgttccgcactacgatatgaag
aatcgtggatttatgctgtggccgctgtttgagattgcaccggagctggcgtttcctgat
ggggagacgttgcgtgaagtcttacatacaagagcatttgacaaattaagcaaatggtaa

DBGET integrated database retrieval system