KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1387Help
Entry
ECO103_1387       CDS       T01096                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465841..1466374
Genome map
AA seq 177 aa AA seqDB search
MSRKLRYGLSAAVLALIAAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGATRVDG
KPVIPGMKLSKEKCDRVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaaactccgctatggtttatcggctgccgttctggcgctgattgccgcaggt
gcttctgcgcctgaaatcctcgaccagtttctggatgaaaaggaaggtaaccacaccacg
gcataccgtgatggtgcgggtatctggaccatctgccgtggagccacccgggtggatggt
aagcctgtgattcctggcatgaagctgtcgaaggaaaaatgcgaccgggttaacgctatc
gaacgggataaggcgctggcatgggtggagcgtaatataaaagttccactgaccgagcca
caaaaagcaggtatcgcgtcattttgcccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggcttaatgcaggcgatcgcaggggagcgtgtgaggcgattcgc
tggtggattaaggacggtggcagagactgccgtatccgttcaaacaactgttacggtcag
gtatcaagacgtgaccaggagagtgcgctggcatgctggggtatcgacaggtaa

DBGET integrated database retrieval system