KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1423Help
Entry
ECO103_1423       CDS       T01096                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00260  Glycine, serine and threonine metabolism
eoh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eoh01100  Metabolic pathways
eoh01110  Biosynthesis of secondary metabolites
eoh01130  Biosynthesis of antibiotics
eoh01230  Biosynthesis of amino acids
Module
eoh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECO103_1423 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECO103_1423 (trpB)
Enzymes [BR:eoh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECO103_1423 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAI30253
UniProt: C8U779
Structure
PDB: 

Jmol
Position
complement(1494117..1495310)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPDKEQLLVVNLSGRGDKDIFTVHDILKAREEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagtgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccactctgtatctcaagcgtgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgtagaa
cgccagtcgcctaacgtttttcgtatgcgcttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctgggcaccgcagctggcccgcatccttatccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaaccaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggcggttcgaatgccatcggcatg
tttgctgatttcatcaatgaaaccaacgtcggcctgattggtgtggagccaggtggtcac
ggtatcgaaactggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatc
tccgccggactggatttcccgtctgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattacgtgtctattaccgatgatgaagcccttgaagccttcaaaacgctgtgc
ctgcacgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgttgaaa
atgatgcgcgaaaacccggataaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgagaggaaatctga

DBGET integrated database retrieval system