KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1530Help
Entry
ECO103_1530       CDS       T01096                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00071  Fatty acid degradation
eoh00280  Valine, leucine and isoleucine degradation
eoh00281  Geraniol degradation
eoh00310  Lysine degradation
eoh00360  Phenylalanine metabolism
eoh00362  Benzoate degradation
eoh00380  Tryptophan metabolism
eoh00410  beta-Alanine metabolism
eoh00627  Aminobenzoate degradation
eoh00640  Propanoate metabolism
eoh00650  Butanoate metabolism
eoh00903  Limonene and pinene degradation
eoh00930  Caprolactam degradation
eoh01100  Metabolic pathways
eoh01110  Biosynthesis of secondary metabolites
eoh01120  Microbial metabolism in diverse environments
eoh01130  Biosynthesis of antibiotics
eoh01212  Fatty acid metabolism
Module
eoh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECO103_1530 (paaF)
   00650 Butanoate metabolism
    ECO103_1530 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ECO103_1530 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECO103_1530 (paaF)
   00310 Lysine degradation
    ECO103_1530 (paaF)
   00360 Phenylalanine metabolism
    ECO103_1530 (paaF)
   00380 Tryptophan metabolism
    ECO103_1530 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECO103_1530 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECO103_1530 (paaF)
   00281 Geraniol degradation
    ECO103_1530 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECO103_1530 (paaF)
   00627 Aminobenzoate degradation
    ECO103_1530 (paaF)
   00930 Caprolactam degradation
    ECO103_1530 (paaF)
Enzymes [BR:eoh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECO103_1530 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAI30354
UniProt: C8U876
Structure
PDB: 

Jmol
Position
1609389..1610156
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQQVLLLTLNRPAARNALNNALLTQLVNELEAAATDSSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacaagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgcccttctgacgcaactggtaaatgaactggaagct
gcggctaccgatagcagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgcccgcagctatgggcgcgattgcaggccttcaacaaacctctcatcgcagccgtcaac
ggttacgcgcttggtgcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttggtttgccggaaatcactctcggcatcatgccaggcgcaggagga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcgtcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system