KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1854Help
Entry
ECO103_1854       CDS       T01096                                 

Gene name
btuE
Definition
(GenBank) predicted glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00480  Glutathione metabolism
eoh00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ECO103_1854 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ECO103_1854 (btuE)
Enzymes [BR:eoh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ECO103_1854 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: BAI30659
UniProt: C8U9S8
Position
complement(1952009..1952560)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagtacgctggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggccgatcgaggttttgtggtg
ctgggattcccgtgcaaccagtttctggaacaagaaccgggcagcgatgaagagattaaa
acttactgtaccaccacatggggggtgacgtttccgatgttcagtaagattgaagttaat
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgaccgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacgggttggtcatccag
cgtttttccccggatatgacgcctgaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system