KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3334Help
Entry
ECO103_3334       CDS       T01096                                 

Gene name
yqcB
Definition
tRNA pseudouridine synthase
Orthology
K06175  
tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
Enzymes [BR:eoh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ECO103_3334 (yqcB)
Transfer RNA biogenesis [BR:eoh03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ECO103_3334 (yqcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3390035..3390817)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GSQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaggatgaatggctggttgcggtaaataaaccctccggctgg
ctggttcaccgcagctggctggatcgcgacgagaaagtagtggtcatgcaaaccgtgcgt
gatcagattggccagcacgtttttaccgctcatcgtctggaccgacccacttctggtgtg
ttgttgatgggattatccagcgaggccggacggctgctggcacaacagtttgaacagcac
caaatccagaaacgttaccatgcgattgtgcgcggctggttgatggaagaagcagttctg
gattatccactggtggaagaactggacaaaatcgctgataaatttgcccgcgaagataaa
ggctcgcagccagcagtgacgcattatcgcggtctggcgaccgtagaaatgccggtagcg
accggacgttacccgaccacgcgctacggcctggtggaactggagccgaaaaccggacgc
aaacatcagcttcgccgacatcttgcccatttgcgtcatccgattattggcgatagcaaa
catggcgatttacgccagaatcgcagcggtgctgagcattttggcctccagcggttaatg
ctacatgccagtcagttgtcattgacgcatccttttactggcgagccgctgactattcac
gcgggcctggacgacacctggatgcaggcgttatcacaatttggctggcgcggtctgctt
cctgaaaatgaaagggttgagttcagtgcgccatcgggtcaggatggagagataagttcc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system