KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3343Help
Entry
ECO103_3343       CDS       T01096                                 

Gene name
fucA
Definition
L-fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eoh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3400074..3400721)
Genome map
AA seq 215 aa AA seqDB search
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVAQALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaataaacttgctcgtcagattattgacacttgcctggaaatgacccgcctg
ggactgaaccaggggacagcggggaacgtcagtgtacgttatcaggatgggatgctgatt
acgcctacaggcattccatatgaaaaactgacggagtcgcatattgtctttattgatggc
aacggtaaacatgaggaaggaaagctcccctcaagcgaatggcgtttccatatggcggcc
tatcaaagcagaccggatgccaacgcggttgttcacaatcatgccgttcattgcacggca
gtttccattcttaaccgatcgatccccgctattcactacatgattgcggcggctggcggt
aattctattccttgcgcgccttatgcgacctttggaacacgtgaactttctgaacatgtt
gcgcaggctctcaaaaatcgtaaggcaactttgttacaacatcatgggcttatcgcttgt
gaggtgaatctggaaaaagcgttatggctggcgcatgaagttgaagtgctggcgcaactt
tacctgacgaccctggcgattacggacccggtgccagtgctgagcgatgaagagattgcc
gtagtgctggagaaattcaaaacctatgggttacgaattgaagagtaa

DBGET integrated database retrieval system