KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_4325Help
Entry
ECO103_4325       CDS       T01096                                 

Gene name
tatC
Definition
TatABCE protein translocation system subunit TatC
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:eoh03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:eoh03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4435799..4436575)
Genome map
AA seq 258 aa AA seqDB search
MSVEDTQPLITHLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMI
ATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYI
GMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCW
MGITSPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGKG
RNREEENDAEAESEKTEE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaagatactcaaccgcttatcacgcatctaattgagctgcgtaagcgtctg
ctgaactgcattatcgcggtgatcgtgatattcctgtgtctggtctatttcgccaatgac
atctatcacctggtatccgcgccattgatcaagcagttgccgcaaggttcaacgatgatc
gccaccgacgtggcctcgccgttctttacgccgatcaagctgacctttatggtgtcgctg
attctgtcagcgccggtgattctctatcaggtgtgggcatttatcgccccagcgctgtat
aagcatgaacgtcgcctggtggtgccgctgctggtttccagctctctgctgttttatatc
ggcatggcgttcgcctactttgtggtctttccgctggcatttggcttccttgccaatacc
gcgccggaaggggtacaggtatccaccgacatcgccagctatttaagcttcgttatggcg
ttgtttatggcgtttggtgtctcctttgaagtgcctgtggcaattgtgctgctgtgctgg
atggggattacctcgccagaagacttacgcaaaaaacgcccgtatgtgctggttggtgca
ttcgttgtcgggatgctgctgacaccgccggatgtcttctcgcaaacgctgttggcgatc
ccgatgtactgtctgtttgaaatcggtgtcttcttctcacgcttttacgttggtaaaggg
cgaaatcgggaagaggaaaacgacgctgaagcagaaagcgaaaaaactgaagaataa

DBGET integrated database retrieval system