KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_4437Help
Entry
ECO103_4437       CDS       T01096                                 

Gene name
bglB
Definition
cryptic phospho-beta-glucosidase B
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eoh00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4560277..4561671
Genome map
AA seq 464 aa AA seqDB search
MKAFPETFLWGGATAANQVEGAWLEDGKGITTSDLQPHGVMGKMEPRILGKENIKDVAID
FYHRYPEDIALFAEMGFTCLRISIAWARIFPQGDEAEPNEAGLAFYDRLFDEMAQAGIKP
LVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINMSLHAP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLIPEAKIGNMLLGGLVYPLTCQPQD
MLEAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDPVGLRVLLNTLWDRYQKPLFIV
ENGLGAKDSVEADGSIQDDYRIAYLNDHLVQVNEAIADGVDIMGYTSWGPIDLVSASHSQ
MSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggcgcaacagctgccaatcaggtggaa
ggtgcctggctggaagatggcaaagggatcacgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttatcaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaattttccctcagggcgacgaagccgaaccgaatgaa
gcggggttagcgttttacgatcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgccatatgggctggtgaaaaactacggcggttgg
gctaatcgggcggtcatcgatcacttcgagcattacgcccgcacggtctttacccgctac
caacataaagtagcgttatggctgacgtttaatgaaatcaatatgtcgttacacgcgcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggcgatccat
catcaactggttgccagtgcgcgggcagttaaagcctgtcatagcctgatccccgaagcg
aaaatcggcaatatgcttctcggcgggctggtttaccccctcacctgccagccacaggat
atgttggaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggtcagtatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacataccgtagatttcatctcttttagttattac
atgactggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatccccaatccgcatctgaaaagttcagagtgggggtggcaaattgatccggtt
ggattacgggttctgttaaatacgctttgggatcgttatcaaaaaccgttatttattgtc
gagaacggattaggcgcaaaagacagcgttgaagcggatggttcgatacaggacgattat
cgaattgcctatttaaacgatcacctggtacaggtaaatgaagcgattgccgatggtgtg
gatattatggggtacaccagttgggggccaattgatttagtcagtgcatctcattcacaa
atgtctaagcgctacggctttatttatgtggatcgtgatgataatggcgaaggaagcctc
acaagaacgcgtaagaaaagcttcggatggtatgcagaagtgatcaaaacgcgggggctg
tcattaaaaaaataa

DBGET integrated database retrieval system