KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_4609Help
Entry
ECO103_4609       CDS       T01096                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00010  Glycolysis / Gluconeogenesis
eoh00051  Fructose and mannose metabolism
eoh00562  Inositol phosphate metabolism
eoh01100  Metabolic pathways
eoh01110  Biosynthesis of secondary metabolites
eoh01120  Microbial metabolism in diverse environments
eoh01130  Biosynthesis of antibiotics
eoh01200  Carbon metabolism
eoh01230  Biosynthesis of amino acids
Module
eoh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eoh_M00002  Glycolysis, core module involving three-carbon compounds
eoh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eoh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO103_4609 (tpiA)
   00051 Fructose and mannose metabolism
    ECO103_4609 (tpiA)
   00562 Inositol phosphate metabolism
    ECO103_4609 (tpiA)
Enzymes [BR:eoh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECO103_4609 (tpiA)
Exosome [BR:eoh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECO103_4609 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECO103_4609 (tpiA)
  Exosomal proteins of melanoma cells
   ECO103_4609 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAI33305
UniProt: C8TZE3
Structure
PDB: 

Jmol
Position
4737905..4738672
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacttctgcc
gctatgctgaaagacatcggcgctcagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagatatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system