KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0507Help
Entry
ECO111_0507       CDS       T01097                                 

Gene name
recR
Definition
gap repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECO111_0507 (recR)
DNA repair and recombination proteins [BR:eoi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ECO111_0507 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
538886..539491
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaacacagcttatggaagcactgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgttcacgctgcttcagcgcgatcgtagcggcggg
atgcgtctggcgcaggcgctcacccgggcgatgtcggaaatcggccactgcgccgattgc
cgcactttcaccgaacaggaagtctgtaacatctgttcgaatccgcgtcgtcaggaaaac
ggtcaaatctgtgtggtggagagtccggcggacatctacgccattgagcagacggggcag
ttttcaggccgttattttgtgttgatggggcacctgtcaccgctggacggcatcggtccg
gatgatatcggccttgatcgtctggaacagcgtctggcagaggaaaaaatcactgaagtg
atcctcgccaccaatcccacggttgaaggtgaagctaccgctaactacattgccgagctt
tgcgcgcaatatgacgtggaagccagccgaatcgctcatggcgtaccggttggcggcgaa
ctggaaatggtcgatggcaccacgctgtcacactcccttgccgggcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system