KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0739Help
Entry
ECO111_0739       CDS       T01097                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00020  Citrate cycle (TCA cycle)
eoi00190  Oxidative phosphorylation
eoi00650  Butanoate metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
Module
eoi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eoi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eoi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECO111_0739 (sdhD)
   00650 Butanoate metabolism
    ECO111_0739 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECO111_0739 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAI34704
UniProt: C8UK21
Structure
PDB: 

Jmol
Position
799009..799356
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system