KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0765Help
Entry
ECO111_0765       CDS       T01097                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00010  Glycolysis / Gluconeogenesis
eoi00260  Glycine, serine and threonine metabolism
eoi00680  Methane metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
eoi01230  Biosynthesis of amino acids
Module
eoi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eoi_M00002  Glycolysis, core module involving three-carbon compounds
eoi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO111_0765 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ECO111_0765 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECO111_0765 (gpmA)
Enzymes [BR:eoi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECO111_0765 (gpmA)
Membrane trafficking [BR:eoi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECO111_0765 (gpmA)
Exosome [BR:eoi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECO111_0765 (gpmA)
  Exosomal proteins of melanoma cells
   ECO111_0765 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: BAI34730
UniProt: C8UK47
Structure
PDB: 

Jmol
Position
complement(829939..830691)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcagaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtcactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccacgttac
gcgaagctgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctaccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagtgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system