KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_1153Help
Entry
ECO111_1153       CDS       T01097                                 

Definition
putative endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1206846..1207379
Genome map
AA seq 177 aa AA seqDB search
MSRKFRYGLSAVVLALIAAGASAPEILDQFLDEKEGNHTTAYRDGVGIWTICRGATRVDG
KPVIPGMKLSKEKCDRVNAIERDKALAWVAKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALSCWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaaattccgctatggtttatcagcggtagttctggcgctgattgccgcaggt
gcttctgcgcctgaaatcctcgaccagtttctggatgaaaaggaaggtaaccacaccacg
gcataccgtgatggtgtgggtatctggaccatctgccgtggagccacccgggtggatggt
aagcctgtgattcctggcatgaagctgtcgaaggaaaaatgcgaccgggttaacgctatc
gaacgggataaggcgctggcatgggtggcgaagaacatcagagtgccactgactgaaccc
cagaaagcgggtattgcgtcattctgtccttacaacattggccccggtaagtgtttcccg
tcgacgttttataaacgaattaatgcaggtgatcgaaaaggtgcctgcgaagcgattcgc
tggtggattaaggacggtggcagagactgccgtatccgctcaaataattgctacggtcag
gtatcaagacgtgaccaggagagtgcgctgtcatgctggggtatcgacaggtaa

DBGET integrated database retrieval system