KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_1564Help
Entry
ECO111_1564       CDS       T01097                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECO111_1564 (galU)
   00052 Galactose metabolism
    ECO111_1564 (galU)
   00500 Starch and sucrose metabolism
    ECO111_1564 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ECO111_1564 (galU)
Enzymes [BR:eoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECO111_1564 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1586035..1586943
Genome map
AA seq 302 aa AA seqDB search
MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaatacgaaagtcaaaaaagccgttatccccgttgcgggattaggaacc
aggatgttgccggcgacgaaagccatcccgaaagagatgctgccacttgtcgataagcca
ttaattcaatacgtcgtgaatgaatgtattgcggctggcattactgaaattgtgctggtt
acacactcatctaaaaactctattgaaaaccactttgataccagttttgaactggaagca
atgctggaaaaacgtgtaaaacgtcaactgcttgatgaagtgcagtctatttgtccaccg
cacgtgactattatgcaagttcgtcagggtctggcgaaaggcctgggacacgcggtattg
tgtgctcacccggtagtgggtgatgaaccggtagctgttattttgcctgatgttattctg
gatgaatatgaatccgatttgtcacaggataacctggcagagatgatccgccgctttgat
gaaacgggtcatagccagatcatggttgaaccggttgctgatgtgaccgcatatggcgtt
gtggattgcaaaggcgttgaattagcgccgggtgaaagcgtaccgatggttggtgtggta
gaaaaaccgaaagcggatgttgcgccgtctaatctcgctattgtgggtcgttacgtactt
agcgcggatatttggccgttgctggcaaaaacccctccgggagctggtgatgaaattcag
ctcaccgacgcaattgatatgctgatcgaaaaagaaacggtggaagcctatcatatgaaa
gggaagagccatgactgcggtaataaattaggttacatgcaggccttcgttgaatacggt
attcgtcataacacccttggcacggaatttaaagcctggcttgaagaagagatgggcatt
aagaagtaa

DBGET integrated database retrieval system