KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_1787Help
Entry
ECO111_1787       CDS       T01097                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00071  Fatty acid degradation
eoi00280  Valine, leucine and isoleucine degradation
eoi00281  Geraniol degradation
eoi00310  Lysine degradation
eoi00360  Phenylalanine metabolism
eoi00362  Benzoate degradation
eoi00380  Tryptophan metabolism
eoi00410  beta-Alanine metabolism
eoi00627  Aminobenzoate degradation
eoi00640  Propanoate metabolism
eoi00650  Butanoate metabolism
eoi00903  Limonene and pinene degradation
eoi00930  Caprolactam degradation
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01212  Fatty acid metabolism
Module
eoi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECO111_1787 (paaF)
   00650 Butanoate metabolism
    ECO111_1787 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ECO111_1787 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECO111_1787 (paaF)
   00310 Lysine degradation
    ECO111_1787 (paaF)
   00360 Phenylalanine metabolism
    ECO111_1787 (paaF)
   00380 Tryptophan metabolism
    ECO111_1787 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECO111_1787 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECO111_1787 (paaF)
   00281 Geraniol degradation
    ECO111_1787 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECO111_1787 (paaF)
   00627 Aminobenzoate degradation
    ECO111_1787 (paaF)
   00930 Caprolactam degradation
    ECO111_1787 (paaF)
Enzymes [BR:eoi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECO111_1787 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAI35696
UniProt: C8UPJ6
Structure
PDB: 

Jmol
Position
1795945..1796712
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgcccagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgttg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system