KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_1856Help
Entry
ECO111_1856       CDS       T01097                                 

Gene name
narV
Definition
nitrate reductase 2 subunit gamma
Orthology
K00374  
nitrate reductase gamma subunit [EC:1.7.99.4]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    ECO111_1856 (narV)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECO111_1856 (narV)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With other acceptors
    1.7.99.4  nitrate reductase
     ECO111_1856 (narV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1870085..1870765)
Genome map
AA seq 226 aa AA seqDB search
MIQYLNVFFYDIYPYICATVFFLGSWLRYDYGQYTWRASSSQMLDKRGMVIWSNLFHIGI
LGIFFGHLFGMLTPHWMYAWFLPVAAKQLMAMVLGGICGVLTLIGGAGLLWRRLTNQRVR
ATSTTPDIIIMSILLIQCLLGLSTIPFSAQYPDGSEMMKLVGWAQSIVTFRGGSSEMLNG
VAFVFRLHLVLGMTIFLLFPFTRLVHVWSAPFEYFTRRYQIVRSRR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgattcagtatctgaacgtctttttttacgatatctacccgtacatttgtgcgacggtg
tttttcctcggcagctggctgcgctacgactacgggcagtacacctggcgcgcctcctca
agtcaaatgctcgataaacgcgggatggtgatatggtcgaatctgttccatatcggcatt
ttggggattttcttcgggcacttgttcggcatgttaacgccgcactggatgtacgcgtgg
tttttgccagtggcagcgaaacaactaatggcgatggtgctcggcggtatttgcggtgtg
ttgacattgattggcggcgcaggactgctgtggcgcaggctgacaaatcagcgcgtgcgt
gcaacttccactacgccggatattatcatcatgagcattttgctgatccagtgtctgctg
gggctaagtaccataccgttttcagcacagtatcctgatggtagcgaaatgatgaagctg
gtgggttgggcgcaaagcattgtcactttccgtggtggatcgtcagaaatgcttaacggc
gtagcgttcgttttccgcctgcatctggtattgggaatgaccatcttcctgctcttcccg
ttcaccagattggtgcatgtgtggagcgcgccgtttgagtactttactcgtcggtatcag
attgtgcgttcgcggcgataa

DBGET integrated database retrieval system