KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_2233Help
Entry
ECO111_2233       CDS       T01097                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00010  Glycolysis / Gluconeogenesis
eoi00030  Pentose phosphate pathway
eoi00051  Fructose and mannose metabolism
eoi00052  Galactose metabolism
eoi00680  Methane metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
eoi01230  Biosynthesis of amino acids
Module
eoi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO111_2233 (pfkB)
   00030 Pentose phosphate pathway
    ECO111_2233 (pfkB)
   00051 Fructose and mannose metabolism
    ECO111_2233 (pfkB)
   00052 Galactose metabolism
    ECO111_2233 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    ECO111_2233 (pfkB)
Enzymes [BR:eoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ECO111_2233 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: BAI36100
UniProt: C8UBH8
Structure
PDB: 

Jmol
Position
2234588..2235517
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALDVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttctctgttggcggatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaaggg
atccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttcccttggtccacaaggagcgctggatgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system