KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_2744Help
Entry
ECO111_2744       CDS       T01097                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase and histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00340  Histidine metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01230  Biosynthesis of amino acids
Module
eoi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ECO111_2744 (hisD)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ECO111_2744 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE
Motif
Other DBs
NCBI-ProteinID: BAI36592
UniProt: C8UCX0
Structure
PDB: 

Jmol
Position
2669393..2670697
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASENITRTVNDILDNVKARGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAHQVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARDLVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELTPQGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaaacattacccgcactgttaacgatattctc
gataacgtgaaagcacgcggcgatgaggccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcactgaaggtgtctgctgaggaaattgccgccgctagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccagtcgcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcgactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttacgcggcgcagctgtgcggcgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtactgaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccag
gtaagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactcacaggtgattttactgacgcccgatgctgatatggcgcatcaa
gttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaaccgcccgtcag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtagagatctcc
aaccagtacggcccggagcacctgatcatccagacccgcaacgcccgcgatctggtcgat
ggcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatccgcaggcgac
tatgcttctggcaccaaccacgttcttccgacctacggctataccgcgacctgctcaagc
cttgggctggctgatttccagaaacggatgaccgtacaggaattaaccccacaaggtttc
tctgccctggcctcaaccattgaaacactggccgctgctgaacgactgactgcccacaaa
aatgccgtcaccctgcgcgttaacgccctgaaggagcaagcatga

DBGET integrated database retrieval system