KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_2744Help
Entry
ECO111_2744       CDS       T01097                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase and histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eoi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:eoi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2669393..2670697
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASENITRTVNDILDNVKARGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAHQVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARDLVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELTPQGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaaacattacccgcactgttaacgatattctc
gataacgtgaaagcacgcggcgatgaggccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcactgaaggtgtctgctgaggaaattgccgccgctagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccagtcgcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcgactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttacgcggcgcagctgtgcggcgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtactgaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccag
gtaagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactcacaggtgattttactgacgcccgatgctgatatggcgcatcaa
gttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaaccgcccgtcag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtagagatctcc
aaccagtacggcccggagcacctgatcatccagacccgcaacgcccgcgatctggtcgat
ggcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatccgcaggcgac
tatgcttctggcaccaaccacgttcttccgacctacggctataccgcgacctgctcaagc
cttgggctggctgatttccagaaacggatgaccgtacaggaattaaccccacaaggtttc
tctgccctggcctcaaccattgaaacactggccgctgctgaacgactgactgcccacaaa
aatgccgtcaccctgcgcgttaacgccctgaaggagcaagcatga

DBGET integrated database retrieval system