KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_3088Help
Entry
ECO111_3088       CDS       T01097                                 

Gene name
yfcX
Definition
(GenBank) fused enoyl-CoA hydratase and epimerase and isomerase/3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00071  Fatty acid degradation
eoi00280  Valine, leucine and isoleucine degradation
eoi00281  Geraniol degradation
eoi00310  Lysine degradation
eoi00362  Benzoate degradation
eoi00380  Tryptophan metabolism
eoi00410  beta-Alanine metabolism
eoi00640  Propanoate metabolism
eoi00650  Butanoate metabolism
eoi00903  Limonene and pinene degradation
eoi00930  Caprolactam degradation
eoi01040  Biosynthesis of unsaturated fatty acids
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
eoi01212  Fatty acid metabolism
Module
eoi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECO111_3088 (yfcX)
   00650 Butanoate metabolism
    ECO111_3088 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    ECO111_3088 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    ECO111_3088 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECO111_3088 (yfcX)
   00310 Lysine degradation
    ECO111_3088 (yfcX)
   00380 Tryptophan metabolism
    ECO111_3088 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECO111_3088 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECO111_3088 (yfcX)
   00281 Geraniol degradation
    ECO111_3088 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECO111_3088 (yfcX)
   00930 Caprolactam degradation
    ECO111_3088 (yfcX)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECO111_3088 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECO111_3088 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECO111_3088 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: BAI36913
UniProt: C8UDU1
Position
complement(3033822..3035966)
Genome map
AA seq 714 aa AA seqDB search
MEMTSAFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEVAVELAKKDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatcagcgtttacccttaatgttcgtctggacaacattgccgttatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgaggcgtggtgtttgtctccgct
aaaccggacaacttcattgctggcgcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagcactggcgcggcagggccaacagttgatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggtggtgggctggagttggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgttgttccgcactccattttgctggaagtcgctgttgag
ctggcgaagaaggatcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagcggttatgacgccgaagctcgggcgtttggcgaactggcgatgacgcca
caatcgcaagctttgcgtagtatcttttttgccagtacggaagtgaagaaagatcccggt
agtgatgcaccgcctgcgccattaaacagcgtgggaattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgccgctcataccattttt
gcttcgaatacgtcatctttaccgattggtgatatcgcagctcacgccacgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtagagattatt
cctcatgcgggtacatcggcgcaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagagcacattgat
gccgcgctagtgaaatttggttttccggtaggtccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
cttgccacgcagtatggttcccgttttaccccttgcgagcgtttggtcgagatgggcgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system