KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_3266Help
Entry
ECO111_3266       CDS       T01097                                 

Gene name
hcaD
Definition
phenylpropionate dioxygenase, ferredoxin reductase subunit
Orthology
K00529  
3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit [EC:1.18.1.3]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Fatty acid degradation
Phenylalanine metabolism
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECO111_3266 (hcaD)
  Lipid metabolism
   00071 Fatty acid degradation
    ECO111_3266 (hcaD)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECO111_3266 (hcaD)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     ECO111_3266 (hcaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3232745..3233947
Genome map
AA seq 400 aa AA seqDB search
MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDERHLPYERPPLSKSMLLEDSPQLQ
QVLPANWWQENNVHLHSGVTIKTLGRDTRELVLTNGESWHWDQLFIATGAAARPLPLLDA
LGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVM
GRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEKVELTLQSGETLQADVVIYGIGIS
ANEQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLDNGALHRCESWENANNQAQ
IAAAAMLGLPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVL
IGAVTLNQGREIRPIRKWIQSGKTFDAKLLIDENIALKSL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaaaccatcattattgtcggtggcgggcaagcggcggcaatggctgcggcc
tcgctacgccagcaagggttcaccggtgagctgcatctgttttccgatgagcgacatctt
ccttatgaacgacctccactctcgaaatccatgttgctggaagattccccgcagttacag
caggtgttacccgctaactggtggcaggaaaacaatgttcatctgcattccggtgtaacc
atcaaaacgctgggtcgcgacacacgagagttagtgttaaccaacggcgaaagctggcac
tgggatcagctttttatagcaaccggcgcggcagctcgaccgctgccgttgcttgatgca
ctgggagaacgctgctttaccctacgccatgccggtgatgccgccagactgcgagaagtt
ctgcagcccgaacggtcagtcgtgattgtcggtgccggaactattggtctggaactggct
gccagcgccacgcagcgcagatgtaaggtgacagtgattgaactggcggcaaccgtcatg
ggccgtaatgcaccaccgcccgtgcaacgctatcttttacagcgccaccagcaggctggt
gtgcgcattctgctcaataatgccattgaacatgtggtcgatggtgaaaaagtagaactg
acgctgcaaagtggggaaacgcttcaggctgatgtggtgatttacggtattggtatcagc
gccaacgagcaactggctcgcgaggccaaccttgatactgccaatggcattgtcattgat
gaggcttgccgcacctgcgatcccgcgatctttgccggtggcgatgtggcaatcactcgt
cttgataatggtgcactacaccgctgcgaaagctgggaaaacgccaataaccaggcgcaa
attgccgctgccgcaatgttagggctaccgctaccgctactgccgccgccgtggttctgg
agcgatcagtacagtgataacttacagtttattggcgatatgcgtggcgatgactggctt
tgtcgtggcaacccggaaactcagaaggcgatttggtttaatctgcaaaacggcgtgctt
atcggtgcggtcacgctgaatcaggggcgtgagattcgcccaattcgcaaatggatccag
agcggcaaaacgtttgatgcgaaactgctgatagatgagaacatcgcgcttaaatcactg
taa

DBGET integrated database retrieval system