KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_3266Help
Entry
ECO111_3266       CDS       T01097                                 

Gene name
hcaD
Definition
phenylpropionate dioxygenase, ferredoxin reductase subunit
Orthology
K00529  
ferredoxin--NAD+ reductase [EC:1.18.1.3]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Fatty acid degradation
Phenylalanine metabolism
Xylene degradation
Aminobenzoate degradation
Ethylbenzene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => 2-oxopent-4-enoate + fumarate
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:eoi01220]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:eoi00071]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:eoi00360]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:eoi00627]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:eoi00622]
Metabolism; Xenobiotics biodegradation and metabolism; Ethylbenzene degradation [PATH:eoi00642]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3232745..3233947
Genome map
AA seq 400 aa AA seqDB search
MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDERHLPYERPPLSKSMLLEDSPQLQ
QVLPANWWQENNVHLHSGVTIKTLGRDTRELVLTNGESWHWDQLFIATGAAARPLPLLDA
LGERCFTLRHAGDAARLREVLQPERSVVIVGAGTIGLELAASATQRRCKVTVIELAATVM
GRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEKVELTLQSGETLQADVVIYGIGIS
ANEQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLDNGALHRCESWENANNQAQ
IAAAAMLGLPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVL
IGAVTLNQGREIRPIRKWIQSGKTFDAKLLIDENIALKSL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaaaccatcattattgtcggtggcgggcaagcggcggcaatggctgcggcc
tcgctacgccagcaagggttcaccggtgagctgcatctgttttccgatgagcgacatctt
ccttatgaacgacctccactctcgaaatccatgttgctggaagattccccgcagttacag
caggtgttacccgctaactggtggcaggaaaacaatgttcatctgcattccggtgtaacc
atcaaaacgctgggtcgcgacacacgagagttagtgttaaccaacggcgaaagctggcac
tgggatcagctttttatagcaaccggcgcggcagctcgaccgctgccgttgcttgatgca
ctgggagaacgctgctttaccctacgccatgccggtgatgccgccagactgcgagaagtt
ctgcagcccgaacggtcagtcgtgattgtcggtgccggaactattggtctggaactggct
gccagcgccacgcagcgcagatgtaaggtgacagtgattgaactggcggcaaccgtcatg
ggccgtaatgcaccaccgcccgtgcaacgctatcttttacagcgccaccagcaggctggt
gtgcgcattctgctcaataatgccattgaacatgtggtcgatggtgaaaaagtagaactg
acgctgcaaagtggggaaacgcttcaggctgatgtggtgatttacggtattggtatcagc
gccaacgagcaactggctcgcgaggccaaccttgatactgccaatggcattgtcattgat
gaggcttgccgcacctgcgatcccgcgatctttgccggtggcgatgtggcaatcactcgt
cttgataatggtgcactacaccgctgcgaaagctgggaaaacgccaataaccaggcgcaa
attgccgctgccgcaatgttagggctaccgctaccgctactgccgccgccgtggttctgg
agcgatcagtacagtgataacttacagtttattggcgatatgcgtggcgatgactggctt
tgtcgtggcaacccggaaactcagaaggcgatttggtttaatctgcaaaacggcgtgctt
atcggtgcggtcacgctgaatcaggggcgtgagattcgcccaattcgcaaatggatccag
agcggcaaaacgtttgatgcgaaactgctgatagatgagaacatcgcgcttaaatcactg
taa

DBGET integrated database retrieval system