KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_4243Help
Entry
ECO111_4243       CDS       T01097                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECO111_4243 (glgB)
Enzymes [BR:eoi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ECO111_4243 (glgB)
Exosome [BR:eoi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECO111_4243 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4230200..4232386)
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHKTTAGLEVRALLPDATDVWVIEPKTGRKLAKL
ECLDSRGFFSGVIPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKYEMIDANGNLRLKSDPYAFEAQMRPETASLICGLPEKVVQTEERKKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGILYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEGNEIIVASNFTPV
PRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPPLAT
IWLVREAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatcgatagagacgtgattaacgcgctaattgcaggccattttgcggat
cctttttccgtactgggaatgcataaaaccaccgcgggactggaagtccgtgccctttta
cccgacgctaccgatgtgtgggtgattgaaccgaaaaccgggcgcaaactcgcaaaactg
gagtgtctcgactcacggggattctttagcggcgtcattccgcgacgtaagaattttttc
cgctatcagttggctgttgtctggcatggtcagcaaaacctgattgatgatccttaccgt
tttggtccgctaatccaggaaatggatgcctggctattatctgaaggtactcacctgcgc
ccgtatgaaaccttaggcgcgcatgcagatactatggatggcgtcacaggtacgcgtttc
tctgtctgggctccaaacgcccgtcgggtctcggtggttgggcaattcaactactgggac
ggtcgccgtcacccgatgcgcctgcgtaaagagagcggcatctgggaactgtttatccct
ggggcgcataacggtcagctctataaatacgagatgattgatgccaatggcaacttgcgt
ctgaagtccgacccttatgccttcgaagcgcaaatgcgcccggaaaccgcgtctcttatt
tgcgggctgccggaaaaggttgtacagactgaagagcgcaaaaaagcgaatcagtttgat
gcgccaatctctatttatgaagttcacctgggttcctggcgtcgccacaccgacaacaat
ttctggttgagctaccgcgagctggccgatcaactggtgccttatgctaaatggatgggc
tttacccacctcgaactactgcccattaacgagcatcccttcgatggcagttggggttat
cagccaaccggcctgtatgcaccaacccgccgttttggtactcgcgacgacttccgttat
ttcattgatgccgcacacgcagctggtctgaacgtgattctcgactgggtgccaggccac
ttcccgactgatgactttgcgcttgccgaatttgatggcacgaacttgtatgaacacagc
gatccgcgtgaaggctatcatcaggactggaacacgctgatctacaactatggtcgccgt
gaagtcagtaacttcctcgtcggtaacgcgctttactggattgaacgttttggtattgat
gcgctgcgcgtcgatgcggtggcgtcaatgatttatcgcgactacagccgtaaagagggg
gagtggatcccgaacgaatttggcgggcgcgagaatcttgaagcgattgaattcttgcgt
aataccaaccgtattcttggtgagcaggtttccggtgcggtgacaatggctgaggagtct
accgatttccctggcgtttctcgtccgcaggatatgggcggtctgggcttctggtacaag
tggaacctcggctggatgcatgacaccctggactacatgaagctcgacccggtttatcgt
cagtatcatcacgataaactgaccttcgggattctctacaactacactgaaaacttcgtc
ctgccgttgtcgcatgatgaagtggtccacggtaaaaaatcgattctcgaccgcatgccg
ggcgacgcatggcagaaattcgcgaacctgcgcgcctactatggctggatgtgggcattc
ccgggcaagaaactactgttcatgggtaacgaatttgcccagggccgcgagtggaaccat
gacgccagcctcgactggcatctgttggaaggcggcgataactggcaccacggtgtccag
cgtctggtgcgcgatctgaacctcacctaccgccaccataaagcaatgcatgaactggat
tttgacccgtacggctttgaatggctggtggtggatgacaaagaacgctcggtgctgatc
tttgtgcgtcgcgataaagagggtaacgaaatcatcgttgccagtaactttacgccggta
ccgcgtcatgattatcgcttcggcataaaccagccgggcaaatggcgtgaaatcctcaat
accgattccatgcactatcacggcagtaatgcaggcaatggcggcacggtacacagcgat
gagattgccagccacggtcgtcagcattcactaagcctgacgctaccaccgctggccact
atctggctggttcgggaggcagaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system