KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_4455Help
Entry
ECO111_4455       CDS       T01097                                 

Gene name
kdtA
Definition
(GenBank) 3-deoxy-D-manno-octulosonic-acid transferase
  KO
K02527  3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00540  Lipopolysaccharide biosynthesis
eoi01100  Metabolic pathways
Module
eoi_M00060  Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ECO111_4455 (kdtA)
Enzymes [BR:eoi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     ECO111_4455 (kdtA)
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     ECO111_4455 (kdtA)
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     ECO111_4455 (kdtA)
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     ECO111_4455 (kdtA)
Glycosyltransferases [BR:eoi01003]
 Polysaccharide
  Bacterial polysaccharide
   ECO111_4455 (kdtA)
Lipopolysaccharide biosynthesis proteins [BR:eoi01005]
 Core region
  ECO111_4455 (kdtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_N Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: BAI38214
UniProt: C8UJ20
Position
4475941..4477218
Genome map
AA seq 425 aa AA seqDB search
MLELLYTALLYLIQPLIWIRLWVRGRKAPAYRKRWGERYGFYRHPLKPGGIMLHSVSVGE
TLAAIPLVRALRHRYPDLPITVTTMTPTGSERVQSAFGKDVQHVYLPYDLPDALNRFLNK
VDPKLVLIMETELWPNLIAALHKRKIPLVIANARLSARSAAGYAKLGKFVRRLLRRITLI
AAQNEEDGARFVALGAKNNQVTVTGSLKFDISVTPQLAAKAVTLRRQWAPHRPVWIATST
HEGEESVVIAAHQALLQQFPNLLLILVPRHPERFPDAINLVRQAGLSYITRSSGEVPSTS
TQVVVGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAAAHAIPVLMGPHTFNFKDICA
RLEQASGLITVTDATTLAKEVSSLLTDADYRSFYGRHAVEVLYQNQGALQRLLQLLEPYL
PPKTH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaattgctttacaccgcccttctctaccttattcagccgctgatctggatacgg
ctctgggtgcgcggacgtaaggctccggcctatcgaaaacgctggggtgaacgttacggt
ttttaccgccatccgctaaaaccaggcggcattatgctgcactccgtctccgtcggtgaa
actctggcggcgatcccgttggtgcgcgcgctgcgccatcgttatcctgatttaccgatt
accgttacaaccatgacgccaaccggttcggagcgcgtacaatcggctttcgggaaggat
gttcagcacgtttatctgccgtatgacctgcccgatgcgctcaaccgtttcctgaataaa
gtcgaccccaaactggtgttgattatggaaaccgaactatggcctaacctgattgcggcg
ctacacaaacgtaaaattccgctggtgatcgctaacgcgcgactctctgcccgctcggcc
gcaggttatgccaaactgggtaaattcgtccgtcgcttgctgcgtcgtattacgctgatt
gctgcgcaaaatgaagaagatggtgcacgttttgtggcgctgggcgcaaaaaataatcag
gtgaccgttaccggtagcctgaaattcgatatttctgtaacgccgcagttggctgctaaa
gccgtgacgctgcgccgccagtgggcaccacaccgcccggtatggattgccaccagcact
cacgaaggcgaagagagtgtggtgatcgccgcacatcaggcattgttacagcaattcccg
aatttattgctcatcctggtaccccgtcatccagaacgcttcccggatgcgattaatctt
gtccgccaggctggactaagctatatcacacgctcttcaggggaagtcccctccaccagc
acgcaggttgtggttggcgatacgatgggcgagttgatgttactgtacggcattgccgat
ctcgcctttgttggcggttcactggttgaacgtggtgggcataatccgctggaagctgcc
gcacacgctattccggtattgatggggccgcatacttttaactttaaagacatttgcgcg
cggctggagcaggcaagcgggctgattaccgttaccgatgccactacgcttgcaaaagag
gtgtcctctttactcaccgacgccgattaccgtagtttctatggccgtcatgccgttgaa
gtactgtatcaaaaccagggcgcgctacagcgtctgcttcaactgctggaaccttacctg
ccaccgaaaacgcattga

DBGET integrated database retrieval system