KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_4455Help
Entry
ECO111_4455       CDS       T01097                                 

Gene name
kdtA
Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:eoi00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4475941..4477218
Genome map
AA seq 425 aa AA seqDB search
MLELLYTALLYLIQPLIWIRLWVRGRKAPAYRKRWGERYGFYRHPLKPGGIMLHSVSVGE
TLAAIPLVRALRHRYPDLPITVTTMTPTGSERVQSAFGKDVQHVYLPYDLPDALNRFLNK
VDPKLVLIMETELWPNLIAALHKRKIPLVIANARLSARSAAGYAKLGKFVRRLLRRITLI
AAQNEEDGARFVALGAKNNQVTVTGSLKFDISVTPQLAAKAVTLRRQWAPHRPVWIATST
HEGEESVVIAAHQALLQQFPNLLLILVPRHPERFPDAINLVRQAGLSYITRSSGEVPSTS
TQVVVGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAAAHAIPVLMGPHTFNFKDICA
RLEQASGLITVTDATTLAKEVSSLLTDADYRSFYGRHAVEVLYQNQGALQRLLQLLEPYL
PPKTH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaattgctttacaccgcccttctctaccttattcagccgctgatctggatacgg
ctctgggtgcgcggacgtaaggctccggcctatcgaaaacgctggggtgaacgttacggt
ttttaccgccatccgctaaaaccaggcggcattatgctgcactccgtctccgtcggtgaa
actctggcggcgatcccgttggtgcgcgcgctgcgccatcgttatcctgatttaccgatt
accgttacaaccatgacgccaaccggttcggagcgcgtacaatcggctttcgggaaggat
gttcagcacgtttatctgccgtatgacctgcccgatgcgctcaaccgtttcctgaataaa
gtcgaccccaaactggtgttgattatggaaaccgaactatggcctaacctgattgcggcg
ctacacaaacgtaaaattccgctggtgatcgctaacgcgcgactctctgcccgctcggcc
gcaggttatgccaaactgggtaaattcgtccgtcgcttgctgcgtcgtattacgctgatt
gctgcgcaaaatgaagaagatggtgcacgttttgtggcgctgggcgcaaaaaataatcag
gtgaccgttaccggtagcctgaaattcgatatttctgtaacgccgcagttggctgctaaa
gccgtgacgctgcgccgccagtgggcaccacaccgcccggtatggattgccaccagcact
cacgaaggcgaagagagtgtggtgatcgccgcacatcaggcattgttacagcaattcccg
aatttattgctcatcctggtaccccgtcatccagaacgcttcccggatgcgattaatctt
gtccgccaggctggactaagctatatcacacgctcttcaggggaagtcccctccaccagc
acgcaggttgtggttggcgatacgatgggcgagttgatgttactgtacggcattgccgat
ctcgcctttgttggcggttcactggttgaacgtggtgggcataatccgctggaagctgcc
gcacacgctattccggtattgatggggccgcatacttttaactttaaagacatttgcgcg
cggctggagcaggcaagcgggctgattaccgttaccgatgccactacgcttgcaaaagag
gtgtcctctttactcaccgacgccgattaccgtagtttctatggccgtcatgccgttgaa
gtactgtatcaaaaccagggcgcgctacagcgtctgcttcaactgctggaaccttacctg
ccaccgaaaacgcattga

DBGET integrated database retrieval system