KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_4961Help
Entry
ECO111_4961       CDS       T01097                                 

Definition
hypothetical protein
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:eoi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eoi01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eoi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eoi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5046130..5046408
Genome map
AA seq 92 aa AA seqDB search
MGGHVAGTAGFCVAVPAFYSWSMSEVIDKDTRSSERTDYPHYASEVALAFGSRVVGLELA
KMIVDAWLGAQYEGGRHQQRVEAITAIEQRRN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtcatgtcgctggcaccgcaggattctgtgttgctgtgccagccttttattca
tggtcaatgagtgaggtgattgataaagacaccaggtcgtcagagcgcactgattatccg
cattatgccagtgaagttgcactggcttttggttcacgagtggttggcctcgaactggca
aaaatgattgtggatgcgtggctgggcgcacagtacgaaggcggtcgtcatcaacaacgc
gtggaggcgattacggcaatagagcagcggagaaattga

DBGET integrated database retrieval system