KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_p1-124Help
Entry
ECO111_p1-124     CDS       T01097                                 

Definition
sulfonamide-resistant dihydropteroate synthase
Orthology
K18824  
dihydropteroate synthase type 1/2 [EC:2.5.1.15]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
Folate biosynthesis
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eoi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECO111_p1-124
Enzymes [BR:eoi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ECO111_p1-124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pO111_1:complement(109568..110383)
Genome map
AA seq 271 aa AA seqDB search
MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVS
SDTEIERIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAK
SSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFF
LGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAA
GGADFIRTHEPRPLRDGLAVLAALKETARIR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgctcatcattttcggcatcgtcaacataacctcggacagtttctccgat
ggaggccggtatctggcgccagacgcagccattgcgcaggcgcgtaagctgatggccgag
ggggcagatgtgatcgacctcggtccggcatccagcaaccccgacgccgcgcctgtttcg
tccgacacagaaatcgagcgtatcgcgccggtgctggacgcgctcaaggcagatggcatt
cccgtctcgctcgacagttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtg
gcctatctcaatgatattcgcggttttccagacgctgcgttctatccgcaattggcgaaa
tcatctgccaaactcgtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgag
gcacccgctggcgacatcatggatcacattgcggcgttctttgacgcgcgcatcgcggcg
ctgacgggtgccggtatcaaacgcaaccgccttgtccttgatcccggcatggggtttttt
ctgggggctgctcccgaaacctcgctctcggtgctggcgcggttcgatgaattgcggctg
cgcttcgatttgccggtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcaca
ggccgtggtccgggggatgtcggggccgcgacactcgctgcagagcttgccgccgccgca
ggtggagctgacttcatccgcacacacgagccgcgccccttgcgcgacgggctggcggta
ttggcggcgctaaaagaaaccgcaagaattcgttaa

DBGET integrated database retrieval system