KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_p2-016Help
Entry
ECO111_p2-016     CDS       T01097                                 

Definition
putative Lysis protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Brite
Enzymes [BR:eoi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECO111_p2-016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pO111_2:complement(15655..16212)
Genome map
AA seq 185 aa AA seqDB search
MKGKTAAGGGAICAIAVMITIVMGNGNVRTNQAGLELIGNAEGCRRDPYMCPAGVWTDGI
GNTHGVTPGVRKTDQQIAADWEKNILIAERCINQHFRGKDMPDNAFSAMTSAAFNMGCNS
LRTYYSKARGMRVETSIHKWAQKGEWVNMCNHLPDFVNSNGVPLRGLKIRREKERQLCLT
GLINE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaaaaacagccgcaggaggcggtgcaatttgcgctatcgcggtgatgattacc
atcgtgatgggtaatggcaatgtgcgaaccaaccaggcggggcttgagctgattggtaac
gctgaaggttgccgacgtgatccatacatgtgcccggcgggggtatggactgacgggatc
ggtaatacacacggggtaacgccgggtgtgcgaaaaaccgaccagcaaatcgccgctgat
tgggaaaagaatatcctgatcgctgaacgctgtattaatcagcactttcggggcaaagac
atgcccgataatgccttcagtgcaatgacaagcgcggcattcaatatgggatgcaatagc
ttacggacctactacagcaaagcgcgaggcatgcgagtcgaaacgtccatccacaagtgg
gcgcagaaaggggaatgggtgaatatgtgtaaccatctccctgattttgtgaacagtaac
ggcgtgcccctgcgaggtttaaagattcgccgtgaaaaagaacgccagctttgcctgacg
gggctgatcaatgaataa

DBGET integrated database retrieval system