KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_0145Help
Entry
ECO26_0145        CDS       T01098                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eoj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(159983..160462)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILAVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccacattcttgccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacctcaacgccgccgtggcg
cttgaaacttcgctcgccccggaagagttactcaaccatacacagcgcatagaactgcaa
cagggtcgtgttcgtaaagctgaacgctggggaccacgcacgctggatctcgatatcatg
ctgtttggtaatgaagtgataaataccgaacgcctgaccgttccgcactacgatatgaag
aatcgtggatttatgctgtggccgctgtttgagattgcaccggagctggcgtttcctgat
ggggagacgttgcgtgaagtcttacatacaagagcatttgacaaattaagcaaatggtaa

DBGET integrated database retrieval system