KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_0298Help
Entry
ECO26_0298        CDS       T01098                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECO26_0298 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECO26_0298 (proB)
Enzymes [BR:eoj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ECO26_0298 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
318893..319996
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgtctgaaccgtgcccatatcgttgaacttgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcgggcgcgatcgccgccggacgtgagcacctg
ggttacccggaactgccagcgactatcgcctcgaaacaactgctggcagcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcgatttatggcattcacgtcgggcaa
atgctgctgacccgtgctgatatggaagaccgtgaacgcttcctgaacgcccgcgacacc
ctgcgtgcgttgctcgataacaatatcgttccggtaatcaatgagaacgatgctgtcgct
acggcagagattaaagtcggcgataacgataacctttctgcgctggcggcgattctggcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtataccgctgacccgcgc
agcaatccgcaggcagaactgattaaagatgtttacggcattgatgacgcactgcgcgcg
attgccggtgacagcgtttcaggcctcggaactggcggcatgagtaccaaattgcaggct
gctgacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtcggtacgctgttccatgcccaggcgact
ccgcttgaaaaccgtaaacgctggattttcggtgcgccgccggcgggtgaaatcacggta
gatgaaggggcaactgccgccattcttgaacgcggcagctccctgttgccgaaaggcatt
aaaagcgtgactggcaatttctcgcgtggtgaagtcatccgcatttgcaacctcgaaggt
cgcgatatcgcccacggcgtcagtcgttacaacagcgatgcattacgccgtattgccggg
caccactcgcaagaaattgatgcaatactgggatatgaatacggcccggttgccgttcac
cgtgatgacatgattacccgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system