KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_0507Help
Entry
ECO26_0507        CDS       T01098                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECO26_0507 (recR)
DNA repair and recombination proteins [BR:eoj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ECO26_0507 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543213..543818
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaacacagcttatggaagcactgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgttcacgctgcttcagcgcgatcgtagcggcggg
atgcgtctggcgcaggcgctcacccgggcgatgtcggaaatcggccactgcgccgattgc
cgcactttcaccgaacaggaagtctgtaacatctgttcgaatccgcgtcgtcaggaaaac
ggtcaaatctgtgtggtggagagtccggcggacatctacgccattgagcagacggggcag
ttttcaggccgttattttgtgttgatggggcacctgtcaccgctggacggcatcggtccg
gatgatatcggccttgatcgtctggaacagcgtctggcagaggaaaaaatcactgaagtg
atcctcgccaccaatcccacggttgaaggtgaagctaccgctaactacattgccgagctt
tgcgcgcaatatgacgtggaagccagccgaatcgctcatggcgtaccggttggcggcgaa
ctggaaatggtcgatggcaccacgctgtcacactcccttgccgggcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system