KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_0738Help
Entry
ECO26_0738        CDS       T01098                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECO26_0738 (asnB)
Enzymes [BR:eoj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ECO26_0738 (asnB)
Peptidases [BR:eoj01002]
 Cysteine Peptidases
  Family C44
   ECO26_0738 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(784290..785954)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgcccacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaactcatgtgctggcggtaaacggtgaaatctacaac
caccaggcactgcgcgccgaatatggcgatcgttatcagttccagaccggatctgactgc
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcatatctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgagcacggtcagctgtatgtggcctca
gaaatgaaagccctggtgccagtttgccgcacgattaaagagttcccggcggggagctat
ttgtggagtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactttgat
gcagtgaaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgtt
aaaagccatctgatgtctgacgttccttacggtgtgctgctctcgggtggtctggattcc
tcaattatttccgcgatcaccaagaaatacgccgcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcaattacactcctttgctgtaggtctgccgggttcaccggat
ctgaaagcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacctatgat
gtgacaactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcaatg
ggcattaaaatggtgctgtccggtgaaggttctgatgaagtgtttggcggttatctttac
ttccacaaagcaccgaatgccaaagaactgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgcgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccgcaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgagtcatac
ctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcggcgcagcaggtttctgatcagcaactggaaact
gcccgcttccgcttcccgtacaacacgccaacctcaaaagaagcgtatctgtaccgggag
atctttgaagaactgttcccgcttccgagcgccgctgagtgcgtgcctggcggtccttcc
gtcgcgtgttcttccgctaaagcgattgagtgggatgaggcgttcaagaaaatggacgat
ccgtctggtcgtgcggttggcgttcaccagtcggcgtataagtaa

DBGET integrated database retrieval system