KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_0809Help
Entry
ECO26_0809        CDS       T01098                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECO26_0809 (gpmA)
   01230 Biosynthesis of amino acids
    ECO26_0809 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO26_0809 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ECO26_0809 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECO26_0809 (gpmA)
Enzymes [BR:eoj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECO26_0809 (gpmA)
Exosome [BR:eoj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECO26_0809 (gpmA)
  Exosomal proteins of melanoma cells
   ECO26_0809 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(869701..870453)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcagaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtcactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccacgttac
gcgaagctgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctaccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagtgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system