KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_1132Help
Entry
ECO26_1132        CDS       T01098                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194491..1195024
Genome map
AA seq 177 aa AA seqDB search
MNEKIKYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDG
KPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWDIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaaataaaatacggcctgtcggctgccgttctggcgctgattggtgcaggt
gcttctgcgcctgaaatcctcgaccagtttctggatgaaaaggaaggtaaccacaccacg
gcataccgtgatggtgcggggatctggaccatctgccgtggtgccattctggtggatggt
aagcctgttattcctggcatgaagctgtcaaaggaaaaatgcgaccgggttaatgccatc
gaacgtgacaaggcgctggcatgggtggagaaaaacatccgggtgccgctgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggccccggtaagtgcttcccg
tcgacgttttataaacgaattaatgcaggcgatcgaaaaggtgcctgtgaggcgattcgc
tggtggattaaggacggtggtagagactgccgtatccgttcaaataattgctacggtcag
gtctcacggcgtgaccaggagagcgcgctggcgtgctgggacatcgacagatag

DBGET integrated database retrieval system