KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_2135Help
Entry
ECO26_2135        CDS       T01098                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO26_2135 (celA)
Enzymes [BR:eoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECO26_2135 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2101329..2102768)
Genome map
AA seq 479 aa AA seqDB search
MSGFKKGFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNH
EAIDFYHRYKTDIQLFAEMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIRFASTVFTRYKEKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDINEREQIMYQAVHYELVASALAVQTGKSINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPEDN
AILASGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFASHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaaaaaggttttttatggggcggtgcggtagccgcgcatcagttggaa
ggtggctggaatgaaggaggaaaaggcatcagcatcgctgatgtgatgactgctggcgct
cacggggtgccgcgtgaagtgacagaaggcgttatcgacgggcttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgagatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctgttcgatgaatgccttaagcag
ggaatggaacctgtggtgacgctttcacattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgaaaccgtaaactgatcgacttttttatccgcttcgcatcaacggtc
ttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatatcaatgagcgcgaacaaataatgtaccaggcggtacattacgagttagttgcc
agtgccctggcggtacagactggaaaatcgatcaatcctgaatttaacattggctgtatg
atcgccatgtgtcccatctatcctctgacgtgtgcacccaacgatatgatgatggccacg
aaagcaatgcatcgtcgttactggtttactgatgttcatgctcgtggatattatccgcaa
catatgctgaattactttgccaggaaaggattcaacctcgatatcacaccagaagataac
gcgattcttgccagtggttgtgtcgactttatcggctttagctactacatgtcttttacg
acacaattttcgcccgataacccgcaactggattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaatggattt
ggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcattgattac
tttgcttcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgacttaatt
ggctacaccccgtggggctgcattgacctggtttctgccggaacaggggaaatgaaaaag
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaacggata
cgtaaagcgtcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatttga

DBGET integrated database retrieval system