KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_2735Help
Entry
ECO26_2735        CDS       T01098                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECO26_2735 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ECO26_2735 (cheB)
Enzymes [BR:eoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ECO26_2735 (cheB)
Two-component system [BR:eoj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ECO26_2735 (cheB)
Bacterial motility proteins [BR:eoj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ECO26_2735 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2644658..2645707)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELSRSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcgcctgatccgctggtc
gcgcgtgacttgattaagaaattcaatcccgatgtgctgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgttgtg
atggtttcttccttgaccggcaaaggatcagaagtcacgctgcgcgcgctggagctgggg
gcaatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacggcagcaaaggcgagccttgcagcacataagcca
ttgtcagcaccgacaacgctgaaggcgggtccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagcccggcattgttaattacccaacatatgccgcccggtttcacccgctcttttgcc
gacagacttaataagctttgccagatcggggttaaagaagccgaagacggagaacgtgtc
ttgccggggcatgcctatattgcgccgggcgatcggcatatggagctgtcgcgtagtggc
gcaaattaccaaatcaaaattcacgatggcccggcggttaaccgtcatcggccttcggta
gatgtgttgttccattctgtcgccaaacaggcggggcgtaatgcggttggggtgatcctg
accggtatgggcaacgacggcgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagccagcaaatgttggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system