KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_2921Help
Entry
ECO26_2921        CDS       T01098                                 

Gene name
sbcB
Definition
exonuclease I
Orthology
K01141  
exodeoxyribonuclease I [EC:3.1.11.1]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eoj03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2836583..2838010
Genome map
AA seq 475 aa AA seqDB search
MMNDGKQQSTFLFHDYETFGTHPALDRPAQFAAIRTDDEFNVIGEPEVFYCKPADDYLPQ
PGAVLITGITPQETRAKGENEAAFAARIHSLFTVPKTCILGYNNVRFDDEVTRNVFYRNF
YDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNA
HDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGMFGAWR
GNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKADLGDTAAVPVKL
VHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIFVEAEPFTPS
DNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLD
YAEQQRWLEHRRQVFTPEFLQGYAEEIQMLAQQYADDKEKVALLKALWQYAEEIV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgacggtaagcaacaatctacctttttgtttcacgattacgaaacctttggc
acgcaccccgcgttagatcgccctgcacagttcgcagccattcgcaccgatgacgaattc
aatgtcatcggcgaacccgaagtcttttactgcaagcccgcggatgactatttaccccag
cctggagcagtattaattaccggtattaccccgcaggagacacgagcgaaaggagaaaac
gaagccgcgtttgccgcccgtattcactcgctttttaccgtaccgaagacctgtattctg
ggctacaacaatgtgcgtttcgacgacgaagtcacacgcaacgttttttatcgtaatttc
tacgatccttacgcctggagctggcagcatgataactcgcgctgggatttactggatgtt
atgcgtgcctgttatgccctgcgcccggaaggaataaattggcctgaaaatgatgacggt
ctaccgagctttcgccttgagcatttaaccaaagcgaatggtattgaacatagcaacgcc
cacgatgcgatggctgatgtgtacgccactattgcgatggcaaaactggtaaaaacgcgt
cagccacgcctgtttgattatctctttacccatcgtaataaacacaaactaatggcgttg
attgatgttcctcagatgaaacccctggttcacgtttccggaatgtttggtgcatggcgc
ggcaatacaagctgggtggcaccgctggcgtggcatcctgaaaatcgcaatgccgtaatt
atggtggatttggcaggagacatttcgccattactggagctggatagcgacacattgcgc
gagcgtttatataccgcaaaagccgatcttggcgataccgccgccgttccggttaagctg
gtacatatcaataaatgtccggtactggcccaggcgaatacgctacgcccggaagatgcc
gaccgactgggaattaatcgtcagcattgcctcgataacctaaaaattctgcgtgaaaat
ccgcaagtgcgtgaaaaagtggtagcgatattcgtggaagccgaaccgtttacaccttca
gataatgtggatgcacagctttataacggctttttcagtgacgccgatcgtgcagcaatg
aaaattgtgctggaaaccgagccgcgtaatttaccggcactggatatcacttttgttgat
aaacgaattgaaaagctgttgttcaattatcgggcgcgcaacttcccggggacgctggat
tatgccgagcagcaacgctggctggagcaccgccgccaggtcttcacgccagagttttta
caaggctatgcagaagagattcagatgctggcgcagcagtatgccgacgataaagaaaaa
gtggcgctgttaaaagcgctttggcagtacgcggaagagattgtctaa

DBGET integrated database retrieval system