KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_2921Help
Entry
ECO26_2921        CDS       T01098                                 

Gene name
sbcB
Definition
exonuclease I
Orthology
K01141  
exodeoxyribonuclease I [EC:3.1.11.1]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    ECO26_2921 (sbcB)
Enzymes [BR:eoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.1  exodeoxyribonuclease I
     ECO26_2921 (sbcB)
DNA repair and recombination proteins [BR:eoj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      ECO26_2921 (sbcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2836583..2838010
Genome map
AA seq 475 aa AA seqDB search
MMNDGKQQSTFLFHDYETFGTHPALDRPAQFAAIRTDDEFNVIGEPEVFYCKPADDYLPQ
PGAVLITGITPQETRAKGENEAAFAARIHSLFTVPKTCILGYNNVRFDDEVTRNVFYRNF
YDPYAWSWQHDNSRWDLLDVMRACYALRPEGINWPENDDGLPSFRLEHLTKANGIEHSNA
HDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKHKLMALIDVPQMKPLVHVSGMFGAWR
GNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKADLGDTAAVPVKL
VHINKCPVLAQANTLRPEDADRLGINRQHCLDNLKILRENPQVREKVVAIFVEAEPFTPS
DNVDAQLYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLFNYRARNFPGTLD
YAEQQRWLEHRRQVFTPEFLQGYAEEIQMLAQQYADDKEKVALLKALWQYAEEIV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgacggtaagcaacaatctacctttttgtttcacgattacgaaacctttggc
acgcaccccgcgttagatcgccctgcacagttcgcagccattcgcaccgatgacgaattc
aatgtcatcggcgaacccgaagtcttttactgcaagcccgcggatgactatttaccccag
cctggagcagtattaattaccggtattaccccgcaggagacacgagcgaaaggagaaaac
gaagccgcgtttgccgcccgtattcactcgctttttaccgtaccgaagacctgtattctg
ggctacaacaatgtgcgtttcgacgacgaagtcacacgcaacgttttttatcgtaatttc
tacgatccttacgcctggagctggcagcatgataactcgcgctgggatttactggatgtt
atgcgtgcctgttatgccctgcgcccggaaggaataaattggcctgaaaatgatgacggt
ctaccgagctttcgccttgagcatttaaccaaagcgaatggtattgaacatagcaacgcc
cacgatgcgatggctgatgtgtacgccactattgcgatggcaaaactggtaaaaacgcgt
cagccacgcctgtttgattatctctttacccatcgtaataaacacaaactaatggcgttg
attgatgttcctcagatgaaacccctggttcacgtttccggaatgtttggtgcatggcgc
ggcaatacaagctgggtggcaccgctggcgtggcatcctgaaaatcgcaatgccgtaatt
atggtggatttggcaggagacatttcgccattactggagctggatagcgacacattgcgc
gagcgtttatataccgcaaaagccgatcttggcgataccgccgccgttccggttaagctg
gtacatatcaataaatgtccggtactggcccaggcgaatacgctacgcccggaagatgcc
gaccgactgggaattaatcgtcagcattgcctcgataacctaaaaattctgcgtgaaaat
ccgcaagtgcgtgaaaaagtggtagcgatattcgtggaagccgaaccgtttacaccttca
gataatgtggatgcacagctttataacggctttttcagtgacgccgatcgtgcagcaatg
aaaattgtgctggaaaccgagccgcgtaatttaccggcactggatatcacttttgttgat
aaacgaattgaaaagctgttgttcaattatcgggcgcgcaacttcccggggacgctggat
tatgccgagcagcaacgctggctggagcaccgccgccaggtcttcacgccagagttttta
caaggctatgcagaagagattcagatgctggcgcagcagtatgccgacgataaagaaaaa
gtggcgctgttaaaagcgctttggcagtacgcggaagagattgtctaa

DBGET integrated database retrieval system