KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_2949Help
Entry
ECO26_2949        CDS       T01098                                 

Gene name
rmlC
Definition
dTDP-6-deoxy-D-glucose-3,5 epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eoj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ECO26_2949 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECO26_2949 (rmlC)
Enzymes [BR:eoj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ECO26_2949 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2863249..2863791)
Genome map
AA seq 180 aa AA seqDB search
MNVIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAVGRKVEFVQDNHSKSSKGVLRG
LHYQLEPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHG
FLVLSEIAEFVYKTTNYYHPESEGCIKWDDSFLMIDWPNKPIAISEKDKKGSSILRLNDY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaattaaaacagaaattccagatgtactgatttttgaaccgaaagtttttggt
gatgagcgtggtttctttatggaaagctttaatcagaaagtttttgaagaagctgtaggg
cggaaggttgaatttgttcaggataatcattctaaatcatctaagggtgtgttacgcgga
ctgcactatcagctggaaccctatgctcaaggtaaattagttcgttgtgtggtcggtgaa
gtatttgatgtagcagttgatattcgtaaatcgtcacctacatttgggaaatgggttggg
gtgaatttgtctgctgagaataagcgtcagttgtggatccctgaggggtttgcgcatggt
tttttggtgttaagcgagatagcagagtttgtttataagacgacaaattattatcatcct
gaatcagaaggttgcataaaatgggatgattcttttttgatgattgattggccaaataaa
ccgatagcaatctcagaaaaagataaaaaaggctcatcaattttgaggctaaatgactat
tga

DBGET integrated database retrieval system