KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_3982Help
Entry
ECO26_3982        CDS       T01098                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Brite
Enzymes [BR:eoj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ECO26_3982 (dsbC)
Secretion system [BR:eoj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ECO26_3982 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3942504..3943214)
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttgtttactttgttagcggcgttttcaggttttgctcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcatcaaaagcagcgatattcag
cccgcgcccgtagctggcatgaagacagttctgactaacagcggcgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagcggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtggttac
tgccacaaactgcatgagcaaatggcagactataacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggacagcgatgcagagaaagaaatgaaagctatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggcaggtaaaagcgtcgcacca
gccagctgcgacgtggatattgccgaccattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gagatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaaataa

DBGET integrated database retrieval system