KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_4035Help
Entry
ECO26_4035        CDS       T01098                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eoj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3998170..3999090)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaatgcctttggtttttta
cgcctgccgatgaacttccagccgtatgacagcgatgctgactgggtgattactggtgtg
ccgttcgatatggccacttctggtcgtgcggggggacgccacggtccggcagctatccgt
caggtttcgacgaatctggcctgggaacacaaccgcttcccgtggaatttcgacatgcgt
gagcgtctgaacgtcgtggactgcggtgatctggtatatgctttcggcgatgcccgtgag
atgagcgagaagctgcaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttacgctgccgctgctgcgtgctcatgcgaagcatttc
ggcaaaatggcgctggtacactttgacgcccacaccgatacctacgcgaacggttgtgaa
tttgaccacggcaccatgttctataccgcgccgaaagaaggtctgatcgatccgaatcat
tccgtgcagattggtattcgtaccgaatttgataaagacaacggctttaccgtgctggac
gcctgccaggtgaacgatcgcagcgtggatgacgttatcgcccaggtgaaacaaattgtg
ggtgatatgccggtttacctgacctttgatatcgactgcctggatcctgcatttgcgccg
ggaaccggtacgccggtaattggcggtctgacctccgatcgcgccattaaactggtacgc
ggcctgaaagatctcaacatcgttgggatggacgtagtggaagtggctccggcatacgat
cagtcggaaatcactgctctggctgcggcgacgctggcgctggagatgctgtatattcag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system