KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_4621Help
Entry
ECO26_4621        CDS       T01098                                 

Gene name
bcsZ
Definition
(GenBank) endo-1,4-D-glucanase BcsZ
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4609976..4611082)
Genome map
AA seq 368 aa AA seqDB search
MNVLRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYG
MFFALAANDRAAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDIW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGF
SAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDW
GQECANSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttgcgtagtggaatcgtgacgatgctgctgctggctgcctttagtgttcag
gcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaaggg
cgcgtcatcgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggc
atgttctttgccctggcggctaacgaccgtgcagctttcgataatattctcgactggacg
cagaacaatctcgctcagggttctttaaaagaacgtttgcccgcctggctgtggggcaag
aaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgatatctgg
atggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatc
ggcagcgcgttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggt
tccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgttttaacccc
agctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggaccacg
ctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggtttttcgccagac
tgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagc
agctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaa
aaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttat
ccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccggtcggtttt
tctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgccagcgc
gtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctgtttgga
caaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactgg
ggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system